Round Cut Diamond Crescent Moon Cartilage Earring

Sale price £354.00 Regular price £407.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

There will be stars in your eyes when you will see this shimmering Diamond Moon Earring. Crafted in solid metal, featuring a crescent moon motif that sparkles with round brilliant cut diamonds in prong setting.

  • Style this Diamond Celestial Earring in your helix, cartilage, conch, or upper lobe piercing. With other piercing jewelry, you will steal the show.
  • The Flat Back Closure serves as a reliable security guard for your Crescent Earring, ensuring a snug and secure fit.
  • Surprise your favorite person on her birthday with this exquisite Diamond Helix Earring because there is no better way to convey that you are special!
  • Symbolising nature, renewal, and feminine energy, style this Moon Stud with diamonds for a personalised ear party stack.
  • To make your special moment even better, this Cartilage Earring comes in a premium storage box, ensuring a luxurious presentation for your gift.
Product Information
SKU SHP-BODYJ052310051
Length 7 mm
Width 5 mm
Height 2 mm
Metal Weight 0.90 gm (Approximate)
Total Stone Weight 0.14 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-2 Pcs
Round-1.80X1.80 mm-2 Pcs
Round-2X2 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More