Round Cut Diamond Flower Stud Earrings for Women

Regular price £565.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

These exquisite Real Diamond Earrings showcase a beautifully intricate floral design that provides a distinctive look. With an elegant yet playful vibe, these Flower Stud Earrings are crafted from premium materials and embellished with round brilliant cut diamonds set in prongs, creating a stunning flower motif. Symbolizing grace and beauty, these Diamond Flower Earrings feature a striking and utterly captivating design, making them a must-have accessory for every woman. Drawing inspiration from nature, these Floral Studs are guaranteed to attract attention and add a touch of glamour to your outfits. For those who value understated elegance, these Everyday Stud Earrings offer a refined yet unique enhancement to your style. They create a lively and mesmerizing look, seamlessly blending contemporary style with timeless charm. The brilliance of the earrings not only adds an extra layer of shine to your appearance but also elevates your confidence to take on the day. These Floral Earrings are equipped with Screw on Backs to ensure they remain securely in place throughout the day. Your Diamond Earrings for Women will be delivered in a signature jewelry box for safe storage when not being worn, along with a certificate of authenticity.

Product Information
SKU SHP-EARRINGS122041796
Length 10.7 mm
Width 10.7 mm
Height 3.3 mm
Metal Weight 1.60 gm (Approximate)
Total Stone Weight 0.84 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.84 Carat (Approximate)
Dimension(approx) Round-1.80X1.80 mm-16 Pcs
Round-3X3 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More