Round London Blue Topaz and Diamond Interlocking Circle Necklace

Sale price £1,104.00 Regular price £1,241.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Express a lasting bond with this Real London Blue Topaz and Diamond Promise Necklace. A rich blue round London Blue Topaz sits at the center of an intertwined circle design, while graduated round diamonds add light across the linked forms. The circle motif gives the necklace a natural connection to unity and continuity, making it a meaningful choice for anniversaries, birthdays, Valentine's gifting, or a personal promise.

1.75 Carat London Blue Topaz and Diamond Circle Necklace

The centerpiece is an approximately 1.35 carat London Blue Topaz measuring 7 x 7 mm. The round gemstone has brilliant-cut faceting, AAA quality, and a prong setting. Twenty round diamonds totaling approximately 0.40 carat accent the intertwined circles in graduated sizes from about 1.20 mm to 1.60 mm. The diamonds are brilliant cut with HI color and SI quality. Crafted in 92.5 sterling silver with an approximate metal weight of 4.11 grams, the necklace is available with an 18-inch adjustable cable chain or without a chain.

What Makes This London Blue Topaz Promise Necklace Special

  • Approximately 1.35 carat round London Blue Topaz centerpiece.
  • 7 x 7 mm blue gemstone with brilliant-cut faceting and AAA quality.
  • Twenty round diamonds totaling approximately 0.40 carat.
  • Graduated diamond sizes create balanced sparkle across the design.
  • Intertwined circle motif frames the center gemstone.
  • Approximately 1.75 carats of combined gemstone and diamond weight.
  • Crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 4.11 grams.
  • Available with an 18-inch adjustable cable chain or as a pendant without chain.

Meaning Behind the London Blue Topaz Interlocking Circle Design

Interlocking circles naturally represent connection, continuity, and two lives held together, giving this promise necklace emotional relevance beyond its color and sparkle. The centered London Blue Topaz draws attention to the heart of the design, while diamond-set circles surround it with graduated brilliance. This combination makes the necklace especially suited to expressing commitment, celebrating an anniversary, or marking a relationship milestone.

London Blue Topaz Necklace Authenticity & Craftsmanship

Rosec Jewels crafts this gemstone necklace with attention to stone placement, secure prong settings, balanced detailing, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to help maintain the London Blue Topaz, diamonds, chain, and metal finish over time.

Styling the London Blue Topaz and Diamond Promise Necklace

The deep blue center stone creates a defined focal point, while the diamond-accented circles add sparkle without overpowering the gemstone. Worn on the 18-inch adjustable cable chain, the pendant works well as a standalone necklace or can be layered with a simpler chain. Its blue-and-silver color combination pairs naturally with everyday outfits, evening looks, and other silver-toned jewelry, while the symbolic circle design also makes it a thoughtful romantic gift.

Product Information
SKU SHP-PENDANT032214558
Metal Weight 4.11 gm (Approximate)
Total Stone Weight 1.75 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 1 Pieces
Total Weight 1.35 Carat (Approximate)
Dimension(approx) Round-7X7 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-2 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-6 Pcs
Round-1.50X1.50 mm-5 Pcs
Round-1.60X1.60 mm-5 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
topaz-necklaces

FAQs About: Real London Blue Topaz and Diamond Promise Necklace

What size and quality is the London Blue Topaz in this promise necklace?

The necklace features one round London Blue Topaz weighing approximately 1.35 carats and measuring about 7 x 7 mm. It has brilliant-cut faceting, blue color, AAA quality, and a prong setting.

How many diamonds are included in the London Blue Topaz necklace?

The design includes 20 round diamonds totaling approximately 0.40 carat. The brilliant-cut diamonds have HI color and SI quality and range from approximately 1.20 mm to 1.60 mm in size.

What does the interlocking circle design symbolize?

The intertwined circles represent connection, continuity, and an enduring bond. Combined with the centered blue gemstone, the motif gives the necklace meaningful relevance for promises, anniversaries, birthdays, and romantic gifting.

What is the total stone weight of this London Blue Topaz and diamond necklace?

The approximately 1.35 carat London Blue Topaz and 0.40 carat of diamonds provide an approximate combined stone weight of 1.75 carats.

What metal and chain options are available for this promise necklace?

The necklace is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 4.11 grams. It can be selected with an 18-inch adjustable cable chain or without a chain.

Does the London Blue Topaz necklace come with a Certificate of Authenticity?

Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for a London Blue Topaz and diamond necklace?

Clean the necklace gently with mild soap, lukewarm water, and a soft cloth, then dry it carefully. Avoid harsh chemicals, abrasive surfaces, and strong impacts, store it separately when not worn, and periodically check the gemstone settings and chain for secure wear.