Round Ruby Infinity jewelry Set with Diamond

0
Regular price £1,279.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Round Ruby Infinity Jewelry Set with Diamond

This jewelry set features round ruby gemstones incorporated into an infinity-inspired design accented with diamonds. The combination of vibrant red rubies and bright diamond accents creates a balanced composition that highlights both color and light reflection.

The infinity motif introduces a symbolic design element, while the gemstones provide visual contrast that enhances the overall appearance of the set.

Infinity Jewelry Design

The infinity symbol is widely recognized in jewelry for representing continuity, connection, and enduring relationships. Its flowing shape creates a symmetrical structure that works well in coordinated jewelry designs.

Because of its recognizable form and balanced proportions, the infinity motif is frequently used in jewelry pieces intended for meaningful gifting.

Gemstone Arrangement

In gemstone jewelry sets, colored stones are often used as focal points while diamonds provide brightness and contrast. This pairing helps emphasize both the color of the primary gemstone and the reflective qualities of the surrounding accents.

The arrangement of rubies and diamonds allows the gemstones to complement each other while maintaining visual balance within the design.

Ruby Gemstone Characteristics

Ruby gemstones are known for their deep red color and have long been used in fine jewelry. Their distinctive tone creates a strong focal point when incorporated into engagement jewelry, pendants, and coordinated sets.

Natural rubies are formed through geological processes and are valued for their unique color and natural origin.

Diamond Accent Details

Diamonds are often used as accent stones to introduce brightness and enhance surrounding gemstones. Their reflective properties help highlight the color of the ruby while contributing subtle sparkle to the design.

The pairing of rubies and diamonds creates a combination that has long been associated with classic gemstone jewelry styles.

Product Information
SKU SHP-PENDANT032210114
Weight 2.40 gm (Approximate)
RUBY INFORMATION
No.of Stones 3 Pieces
Total Weight 0.77 Carat (Approximate)
Dimension(approx) Round-2X2 mm-2 Pcs
Round-5X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 80 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-42 Pcs
Round-1.20X1.20 mm-13 Pcs
Round-1.30X1.30 mm-3 Pcs
Round-1.40X1.40 mm-21 Pcs
Round-1.50X1.50 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
ruby-necklace

FAQs About: Round Ruby Infinity Jewelry Set with Diamond

What does the infinity symbol represent in jewelry?
The infinity symbol is commonly associated with continuity, lasting relationships, and enduring connections.
What makes ruby gemstones distinctive?
Rubies are known for their rich red color and have long been valued in jewelry for their distinctive appearance.
Why combine rubies with diamonds?
Rubies add vibrant color while diamonds introduce brightness and sparkle, creating contrast within the jewelry design.
What is a jewelry set?
A jewelry set typically includes multiple coordinated pieces designed to complement one another when worn together.
Are ruby jewelry sets suitable for gifting?
Ruby jewelry sets are often chosen as gifts because their vibrant color and coordinated design make them suitable for many occasions.
Do diamond accents enhance gemstone jewelry?
Diamond accents are commonly used to add light reflection and highlight the color of surrounding gemstones.