Split Shank Amethyst Flower Engagement Ring with Diamond

Regular price £882.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral-Inspired Amethyst Engagement Ring

This amethyst engagement ring combines gemstone elegance with nature-inspired design. At the center of the ring is a vivid amethyst gemstone arranged within a floral-style setting, creating a design that reflects both structure and organic beauty. The rich purple tone of amethyst brings a distinctive color presence, offering a refined alternative to traditional engagement ring gemstones.

Floral engagement rings are often chosen by those who appreciate artistic jewelry with symbolic meaning. The flower-inspired arrangement highlights the gemstone while introducing graceful detail that makes the ring feel unique and expressive.

Split Shank Design with Diamond Accents

The ring features a split shank band that gently separates as it approaches the center setting. This structural detail adds visual dimension while guiding attention toward the central floral design. Split shank rings are valued for their balanced appearance and the sense of openness they bring to the overall composition.

Diamond accents are incorporated into the setting to introduce subtle brilliance around the amethyst centerpiece. These accent stones complement the gemstone’s rich color while enhancing the overall visual contrast of the design.

The Appeal of Amethyst in Engagement Jewelry

Amethyst is admired for its distinctive purple color, which can range from soft violet to deeper royal tones. This gemstone has long been associated with elegance and individuality, making it an appealing option for engagement rings that depart from traditional colorless stones.

The gemstone’s color naturally draws attention within the floral setting, while its faceted surface reflects light to create a lively appearance. Together, the gemstone and setting create a ring that balances color, detail, and elegance.

A Distinctive Ring with Artistic Character

This ring brings together a nature-inspired motif with structured gemstone placement. The flower-style setting, combined with the split shank band, gives the design depth and movement while keeping the amethyst gemstone as the focal point.

For buyers seeking an engagement ring with expressive detail and meaningful design inspiration, this amethyst ring offers a refined choice that blends gemstone color with delicate craftsmanship.

Product Information
SKU SHP-RINGS0821221708
Width 3.8 mm
Height 7 mm
Metal Weight 2.38 gm (Approximate)
Total Stone Weight 0.77 Carat (Approximate)
AMETHYST INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Violet
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Marquise-1.50X3.00 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round, Marquise
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
february-birthstone-jewelry

FAQs About: Split Shank Amethyst Flower Engagement Ring with Diamond

What is a split shank engagement ring?
A split shank engagement ring features a band that divides into two sections as it approaches the center stone. This design adds dimension to the ring and helps frame the central gemstone.
What does a floral engagement ring design represent?
Floral engagement rings are inspired by the shapes and patterns found in flowers. These designs are often chosen for their artistic appearance and their symbolic connection to growth and beauty.
Is amethyst suitable for an engagement ring?
Amethyst is selected for engagement rings by those who appreciate its distinctive purple color and unique character. With proper care and secure setting, it can be enjoyed as a meaningful gemstone choice.
What role do diamonds play in this ring design?
Diamonds are used as accent stones to add subtle brilliance around the center gemstone. They enhance the overall contrast and highlight the amethyst centerpiece.
Can this ring be paired with a wedding band?
Yes. Many engagement rings with decorative settings can be paired with complementary wedding bands depending on the preferred style and how closely the band sits next to the ring.