Tahitian Pearl and Diamond Flower Bypass Ring

Regular price £988.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

The glistening bypass shank holds an eye-pleasing round Tahitian Pearl, that is surrounded by a floriated metal motif. Perfectly cut and polished round Diamond adorn the shank band and complete this finely crafted solitaire ring. If you are an admirer of rare beauties, then get this minimalist ring for yourself as a token of self-love or present it to someone who lights up your life.

Product Information
SKU SHP-RINGS0821238023
Width 8 mm
Height 6.5 mm
Metal Weight 3.20 gm (Approximate)
Center Stone Weight 7.50 Carat (Approximate)
TAHITIAN PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 7.50 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
tahitian-pearl-engagement-rings