Tahitian Pearl Crossover Diamond Infinity Engagement Ring

Sale price £962.00 Regular price £1,081.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This engagement ring features a Tahitian pearl as the centerpiece, complemented by diamond accents and a crossover infinity design. The pearl’s distinctive tone becomes the focal point of the ring, while the surrounding elements create a balanced composition that blends color, luster, and symbolic detail.

Pearl engagement rings offer an alternative to traditional gemstone styles, appealing to those who prefer refined elegance and distinctive natural beauty. The crossover structure introduces movement within the design while keeping the pearl visually prominent.

Crossover Infinity Design

The ring incorporates a crossover infinity motif, where the band curves and intersects to form a continuous loop pattern. This design represents continuity and lasting connection while creating a graceful visual flow around the center pearl.

The crossover structure also allows diamond accents to frame the pearl subtly, contributing brilliance without overwhelming the primary gemstone.

Tahitian Pearl Centerpiece

Tahitian pearls are known for their natural luster and distinctive dark tones. Their smooth surface and reflective qualities create a soft glow that differs from the sparkle typically associated with faceted gemstones.

Because each pearl forms naturally, slight variations in tone and surface characteristics contribute to the individuality of pearl jewelry.

Diamond Accents and Visual Balance

Diamond accents are incorporated into the design to introduce additional brilliance while maintaining visual harmony with the pearl centerpiece. Their placement within the crossover band enhances light reflection without detracting from the pearl’s natural luster.

Together, the pearl, diamonds, and infinity motif create a design that combines symbolic meaning with elegant structure.

Product Information
SKU SHP-RINGS0821211079
Width 2 mm
Metal Weight 3.60 gm (Approximate)
Center Stone Weight 7.50 Carat (Approximate)
TAHITIAN PEARL INFORMATION
No.of Stones 1 Pieces
Total Weight 7.50 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.21 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-2 Pcs
Round-1.30X1.30 mm-17 Pcs
Round-1.40X1.40 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade SI
View More

Product Parent Collection Handle
tahitian-pearl-engagement-rings

FAQs About: Tahitian Pearl Crossover Diamond Infinity Engagement Ring

What makes Tahitian pearls unique?
Tahitian pearls are known for their naturally dark tones and distinctive luster, giving them a unique appearance compared to traditional white pearls.
Can pearls be used in engagement rings?
Pearls are sometimes chosen for engagement rings by those who prefer a distinctive and elegant alternative to traditional gemstone designs.
What does the infinity design symbolize in jewelry?
Infinity motifs in jewelry typically represent continuity and enduring connection due to their continuous loop form.
Why are diamonds paired with pearls in ring designs?
Diamonds add brilliance and contrast to the smooth luster of pearls, creating a balanced combination of sparkle and soft reflection.
What is a crossover ring design?
A crossover ring design features bands that curve and intersect around the center element, creating a flowing and layered visual structure.
Are pearl rings considered unique engagement styles?
Pearl engagement rings are often selected by individuals seeking distinctive jewelry that differs from traditional gemstone engagement rings.