Unique Marquise Diamond Cartilage Piercing Earring

Sale price £464.00 Regular price £533.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the leaves, this Diamond Cartilage Earring features marquise shape diamonds that looks like sparkling leaves, with dainty round diamonds on the half circle motif.

  • This diamond earring is a perfect addition to your piercing jewelry collection. You can style it on your helix, cartilage, or upper lobe piercing.
  • The Flat Back Closure will keep this Diamond Helix Piercing Earring tightly intanced to its place.
  • And heres a pro tip, gift this jaw-dropping marquise diamond earring to your special someone on their birthday. Trust us, youll be adding a whole lot of sparkle and joy to their day.
Product Information
SKU SHP-BODYJ082410139
Length 8.2 mm
Width 9.5 mm
Height 1.8 mm
Metal Weight 1.40 gm (Approximate)
Total Stone Weight 0.44 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.44 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-2 Pcs
Marquise-2X4 mm-3 Pcs
Round-1X1 mm-7 Pcs
Color HI
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade SI
View More