Vintage Inspired Emerald Flower Engagement Ring

Sale price £934.00 Regular price £1,026.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K Yellow Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by vintage artistry and the natural beauty of blooming flowers, this Vintage Emerald Ring captures the essence of devotion and grace in every detail. Designed to symbolize enduring commitment, this Emerald Engagement Ring beautifully blends the charm of nature with classic sophistication. It is embellished with a 5 MM round cut emerald, securely held in prong setting. Surrounding the central stone are smaller round emeralds, delicately arranged to form a graceful flower motif. Each stone is thoughtfully set over finely detailed metal leaf, creating a captivating design that draws inspiration from both nature and vintage elegance. The combination of intricate craftsmanship and the emerald's vivid color makes this Vintage Floral Engagement Ring a versatile and remarkable piece of jewelry. Whether worn as an engagement ring, anniversary gift, or a personal statement of love, it carries a sense of history and emotional depth. Perfect for those who appreciate timeless beauty, this Emerald Flower Ring brings together romance, artistry, and natural charm. Its rich green tones complement any style, making it a lasting symbol of affection and elegance.

Product Information
SKU SHP-RINGS0721117399
Width 5 mm
Height 9 mm
Metal Weight 2.24 gm (Approximate)
Total Stone Weight 0.80 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 7 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-2X2 mm-6 Pcs
Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
vintage-inspired-engagement-rings