0.5 Carat Natural Round Ruby Half Eternity Band Ring

Sale price £350.00 Regular price £385.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Mark a lasting bond with the rich red color of this ruby semi eternity ring. Nine round rubies form a continuous line of color across the front of the band, creating a refined half-eternity look that feels meaningful for anniversaries, wedding milestones, July birthstone gifting, or a personal celebration. With approximately 0.54 carat of AAA-quality rubies, the design balances vivid gemstone presence with a slim, easy-to-style profile.

0.54 Carat Round Ruby Semi Eternity Ring with Bar Setting

The ring is set with nine round rubies measuring approximately 2 x 2 mm each and totaling about 0.54 carat. Each red gemstone has a brilliant cut and AAA quality grade, while the sleek bar setting creates a structured line of color across the band. Measuring approximately 1.5 mm in width and 1.4 mm in height, the design keeps the gemstone row refined rather than bulky. Metal options include 92.5 sterling silver and 10K, 14K, or 18K white and yellow gold.

Standout Details of This Ruby Half Eternity Ring

  • Nine round red rubies
  • Approximately 0.54 carat total ruby weight
  • AAA-quality gemstones
  • Approximately 2 x 2 mm round rubies
  • Brilliant-cut faceting
  • Bar setting for a clean, structured gemstone row
  • Semi eternity or half eternity design
  • Approximately 1.5 mm band width
  • Approximately 1.4 mm ring height
  • Approximate metal weight of 1.76 grams
  • Available in sterling silver, white gold, and yellow gold options

The nine-stone arrangement concentrates vivid ruby color across the visible front of the finger, while the narrow proportions give the ring a polished look that works equally well worn alone or alongside other bands.

Meaning Behind a Ruby Semi Eternity Ring

A semi eternity design places a continuous sequence of gemstones across the most visible part of the band, making it a natural symbol of an ongoing bond without surrounding the entire ring with stones. The repeated red rubies bring a strong romantic character to that idea, while the bar setting creates a clean rhythm from one gemstone to the next. This makes the ring especially suited to anniversaries, relationship milestones, wedding-band styling, or a meaningful July birthstone gift.

Ruby Ring Craftsmanship & Authenticity

Rosec Jewels crafts the ring with attention to ruby alignment, bar-setting security, balanced proportions, and refined finishing. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch. Rosec Jewels also offers a Certificate of Authenticity with its jewelry, adding confidence to the purchase experience. Gentle cleaning, separate storage, and periodic setting checks can help preserve the gemstone row and metal finish over time.

Styling and Wearing a Ruby Half Eternity Band

The slim 1.5 mm profile makes this ruby semi eternity band easy to style without losing the impact of its red gemstone row. Wear it alone for a focused pop of color, pair it with an engagement ring, or add it to a mixed-metal or gemstone stack. Sterling silver and white gold create a cool-toned contrast with the rubies, while yellow gold adds a warmer frame around the red stones. Multiple metal purities and ring-size choices make the design adaptable to anniversary, wedding, birthstone, and everyday jewelry styling.

Product Information
SKU SHP-RINGS032151535
Width 1.5 mm
Height 1.4 mm
Weight 1.76 gm (Approximate)
RUBY INFORMATION
No.of Stones 9 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-2X2 mm-9 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Bar-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
ruby-rings

FAQs About: Real Ruby Semi Eternity Ring

How many rubies are set in this semi eternity ring?

The ring contains nine round red rubies with an approximate total weight of 0.54 carat. Each gemstone measures about 2 x 2 mm.

What quality and cut are the rubies in this ring?

The rubies have an AAA quality grade and brilliant-cut faceting. Their round shape creates a consistent line of red color across the front of the band.

What setting style is used for the ruby half eternity band?

The nine round rubies are secured in a bar setting. This creates a structured gemstone row while keeping each ruby visually defined along the semi eternity design.

What does a ruby semi eternity ring symbolize?

The repeating gemstone row can represent an ongoing bond and continuing commitment. Combined with the rich red color of ruby, the design is especially meaningful for anniversaries, wedding milestones, romantic gifting, and July birthstone occasions.

What metal options are available for this ruby eternity ring?

The ring is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Does this ruby semi eternity ring come with a Certificate of Authenticity?

Yes. Rosec Jewels offers a Certificate of Authenticity with its jewelry. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for a ruby semi eternity ring?

Clean the ring gently with mild soap, lukewarm water, and a soft cloth or brush. Keep it away from harsh chemicals and strong impact, store it separately when not worn, and have the bar settings checked periodically if the ring is worn frequently.