1.75 Carat Pear Shape Black Spinel Statement Necklace with Moissanites

Sale price £228.00 Regular price £256.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make a striking style statement with this captivating Black Spinel Pendant, designed for those who appreciate dramatic elegance and bold detail. Showcasing a 7X10MM pear shaped AAA quality black spinel, securely held in prong setting that highlights its teardrop form. Accentuating the black spinel are petite D-VS1 quality moissanites, thoughtfully arranged to add contrast and radiant sparkle. An intricately designed infinity motif, fully adorned with shimmering stones, wraps around the spinel to create a visually dynamic and artistic look. The interplay between the dark gemstone and bright moissanites delivers a captivating balance of brilliance and depth. Crafted with precision and high-quality materials, this Teardrop Pendant Necklace is designed to elevate formal attire and evening ensembles. Its bold character and luminous detailing make it a standout Cocktail Pendant for special occasions and elegant gatherings. The Black Spinel and Moissanite Necklace is thoughtfully packaged in a premium-quality jewelry box, ensuring safe storage and a polished presentation.

Product Information
SKU SHP-PENDANT062310065
Metal Weight 3.48 gm (Approximate)
Total Stone Weight 2.05 Carat (Approximate)
BLACK SPINEL INFORMATION
No.of Stones 1 Pieces
Total Weight 1.75 Carat (Approximate)
Dimension(approx) Pear-7X10 mm-1 Pcs
Color Black
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade AAA
MOISSANITE INFORMATION
No.of Stones 62 Pieces
Total Weight 0.30 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-1 Pcs
Round-1.10X1.10 mm-2 Pcs
Round-1.40X1.40 mm-1 Pcs
Round-1.50X1.50 mm-1 Pcs
Round-1X1 mm-57 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
black-spinel-necklaces