2.4 Carat Heart Lab Grown Black and White Diamond Solitaire Necklace

Sale price £222.00 Regular price £255.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Symbolizing everlasting emotions, this Lab Grown Black Diamond Necklace honors enduring connections. Meticulously crafted with precision, this Heart Solitaire Pendant features an 8 mm Heart Shape Lab Grown Black Diamond set in a Prong Setting, serving as a Solitaire. Additionally, the two round brilliant cut Lab Grown Diamond gems sparkling from the top enhance its appeal, making it an ideal accessory for significant events. Suspended from a chain, this Heart Locket embodies eternal bonds and aspirations. This Solitaire Necklace signifies a future brimming with remarkable brilliance and optimism. The AAAA quality Lab Grown Black Diamond emits a radiance and fire that endures through time. The Lab Diamond Heart Necklace has emerged as an exceptional and timeless selection in the realm of fashion. Its vibrant heart motif acts as a perpetual reminder of the passionate and lasting love that nourishes the spirit, a promise kept close to your own beating heart. It represents infinity and everlasting love, making it a cherished gift that encapsulates and celebrates your boundless love narrative.

Product Information
SKU SHP-PENDANT122310123
Metal Weight 3.10 gm (Approximate)
Total Stone Weight 2.42 Carat (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 2.40 Carat (Approximate)
Dimension(approx) Heart-8X8 mm-1 Pcs
Color Black
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAAA ( Synthetic )
LAB GROWN DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.02 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-1 Pcs
Round-1.50X1.50 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More