2 CT Heart Shape Black Onyx Solitaire Pendant

Regular price £232.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Steal hearts with this striking Black Onyx Pendant Necklace, created to express deep emotions with bold style and timeless charm. The Solitaire Pendant features an 8 MM heart shaped black onyx secured in 3-prong setting. Black onyx is admired for its dramatic appearance and symbolic strength, making this piece a powerful expression of love, devotion, and confidence. Enhancing the design is a uniquely styled bail that adds extra character and draws attention to the heart motif. The thoughtful detailing gives the Black Heart Necklace a distinctive look that feels both romantic and modern. Crafted in high quality metal, this Heart Locket Necklace is made for lasting wear and everyday comfort, while still carrying a meaningful presence. Suspended from a coordinating chain, the pendant rests gracefully along the neckline and pairs easily with both casual outfits and dressier looks. This necklace works wonderfully for anniversaries, Valentine’s Day, proposals, birthdays, weddings, or as a heartfelt surprise just because. Whether celebrating romance, friendship, or a special milestone, this piece tells a story filled with emotion, intention, and lasting beauty.

Product Information
SKU SHP-PENDANT012148071
Length 13.8 mm
Width 7.9 mm
Height 5.5 mm
Metal Weight 2.80 gm (Approximate)
Total Stone Weight 2.10 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 1 Pieces
Total Weight 2.10 Carat (Approximate)
Dimension(approx) Heart-8X8 mm-1 Pcs
Color Black
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-onyx-necklaces