Certified 1.2 Carat Lab Grown Diamond Celtic Design Engagement Ring

Regular price £395.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Drawing inspiration from the vintage era, this Lab Grown Diamond Engagement Ring showcases a timeless beauty that is ideal for her. At the center of the ring, a 7 MM round cut lab created diamond is elegantly set in prong setting. The wide band features an intricate design of Celtic Knots, exuding exceptional elegance and infusing the design with a romantic and old-world charm. Additionally, the Solitaire Diamond Engagement Ring includes a surprise diamond nestled in a flower motif beneath the main stone, while the front side of the band is embellished with beaded detailing for a regal appearance. The brilliance of EF-VS Quality synthetic diamonds embodies qualities such as grace, beauty, and strength, making this Vintage Style Ring a perfect way to convey your love for her. This Celtic Design Engagement Ring is a wonderful choice for the big day, adding an extra touch of charm and sparkle to the occasion. We will ship this 1 Carat Diamond Ring for Women in Premium Jewelry Box to make it a Ready to Gift Ring on special occasions like Valentines Day, Wedding Day, Thanksgiving, Birthday and many more.

Product Information
SKU SHP-RINGS052410203
Width 6 mm
Height 7 mm
Metal Weight 4.11 gm (Approximate)
Center Stone Weight 1.28 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 3 Pieces
Total Weight 1.31 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-2 Pcs
Round-7X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More