Certified 1.2 Carat Lab Grown Diamond Celtic Design Engagement Ring

Sale price £994.00 Regular price £1,142.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 14K White Gold
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Drawing inspiration from the vintage era, this Lab Grown Diamond Engagement Ring showcases a timeless beauty that is ideal for her. At the center of the ring, a 1.2 Carat round cut lab created diamond is elegantly set in prong setting. The wide band features an intricate design of Celtic Knots, exuding exceptional elegance and infusing the design with a romantic and old-world charm. Additionally, the Diamond Solitaire Engagement Ring includes a surprise diamond nestled in a flower motif beneath the main stone, while the front side of the band is embellished with beaded detailing for a regal appearance. The brilliance of EF-VS Quality synthetic diamonds embodies qualities such as grace, beauty, and strength, making this Vintage Style Ring a perfect way to convey your love for her. This Celtic Design Engagement Ring is a wonderful choice for the big day, adding an extra touch of charm and sparkle to the occasion. We will ship this 1.2 Carat Diamond Ring for Women in Premium Jewelry Box to make it a Ready to Gift Ring on special occasions like Valentines Day, Wedding Day, Thanksgiving, Birthday and many more.

Product Information
SKU SHP-RINGS052410203
Width 6 mm
Height 7 mm
Metal Weight 4.11 gm (Approximate)
Center Stone Weight 1.28 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 3 Pieces
Total Weight 1.31 Carat (Approximate)
Dimension(approx) Round-7X7 mm-1 Pcs
Round-1.50X1.50 mm-2 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More