Certified 2 Carat Lab Grown Emerald Diamond Engagement Ring with Flower

Sale price £317.00 Regular price £364.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the beauty of nature, this Flower Engagement Ring is a celebration of love in full bloom. This Fine Engagement Ring features an 8 mm Round Shape Lab Created Emerald set in 6 Claw Prong Setting, its rich green hue symbolizing both life and lasting commitment. Crafted sustainably, this AAAA Quality Lab Emerald offers the brilliance of nature, with the bonus of being an eco-friendly choice. On either side of the center stone, delicate Rose Flower Motif takes shape, gracefully framing the Lab Emerald in a way that feels both timeless and fresh. Each Flower is carefully designed to enhance the beauty of Lab Emerald, giving this Lab Grown Emerald Ring a soft, feminine touch. And adding even more sparkle, a Diamond rests at the side of each flower, radiating light with every movement. This Lab Emerald Diamond Engagement Ring is for those who want something more than just a traditional design. It is a blend of elegance and artistry, a piece that captures the essence of nature and the beauty of everlasting love. Perfect for someone who sees their love as a constant bloom, this Solitaire Engagement Ring with Emerald promises to be as unique and extraordinary as the bond it represents.

Product Information
SKU SHP-RINGS0821201964
Width 6.5 mm
Height 8 mm
Metal Weight 4.40 gm (Approximate)
Center Stone Weight 2.18 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 2.18 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type 6-Claw-Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 6-Claw-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-emerald-engagement-rings