Certified 6 Carat Lab Grown Emerald Statement Engagement Ring with Diamond

Sale price £358.00 Regular price £412.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Graceful and full of life, this Oval Emerald Engagement Ring captures the feeling of a love that is always blooming. Designed to capture attention, this Solitaire Engagement Ring features a big 10X14 mm Oval Shape Lab Created Emerald set in Prong Setting, rich in color and meaning. Its deep green glow symbolizes renewal, harmony and everlasting love, perfect for the beginning of your forever. What makes this Big Engagement Ring truly special are the Butterfly motif on each side of the center stone. Crafted with care and adorned with dainty Diamond stones, the butterflies appear as if gently resting beside the Lab Emerald, adding a soft, whimsical touch that is full of movement and meaning. Butterflies are symbols of transformation and hope, making them a beautiful way to celebrate your love story. The mix of fine sparkle, graceful curves and butterfly design makes this Lab Emerald Diamond Engagement Ring a standout, romantic, elegant and unlike anything else. Available in various ring sizes and delivered in a jewelry box, this Lab Emerald Ring for Engagement is ready to be part of your most unforgettable moment. For the dreamer, the nature lover and the one who finds beauty in every little detail, this Butterfly Engagement Ring is a poetic expression of love in full flight.

Product Information
SKU SHP-RINGS062310093
Metal Weight 4.60 gm (Approximate)
Center Stone Weight 6.00 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 6.00 Carat (Approximate)
Dimension(approx) Oval-10X14 mm-1 Pcs
Color Green
Cut Brilliant
Shape Oval
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1.40X1.40 mm-4 Pcs
Round-1.70X1.70 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-emerald-rings