Certified Lab Grown Blue Sapphire Marquise Engagement Ring with Celtic Knot

Sale price £188.00 Regular price £216.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

A symbol of timeless love and intricate beauty, this Marquise Engagement Ring captures hearts at first glance. At its center, a stunning 4X8 mm Marquise Shaped Lab Created Blue Sapphire set in Bezel Setting sparkles with a depth of color that evokes the calm brilliance of a clear midnight sky. Flanking the gemstone, the Celtic knot represents eternal connection and the intertwining of two lives. This Lab Grown Blue Sapphire Engagement Ring thoughtfully crafted to celebrate romance and commitment, making it a perfect choice for a proposal that is both meaningful and memorable. The Celtic Knot Engagement Ring comes in a variety of ring sizes, allowing you to choose the one that fits your love story perfectly. Presented in a signature jewelry box, this Solitaire Engagement Ring is ready to become a cherished keepsake, treasured for generations. Designed to shine in everyday light as well as special occasions, the combination of the vibrant AAAA Quality Lab Grown Blue Sapphire and the timeless Celtic motif makes it a ring that stands out, a true emblem of devotion, elegance and the promise of forever together.

Product Information
SKU SHP-RINGS0821223589
Width 2.4 mm
Height 8.2 mm
Metal Weight 2.33 gm (Approximate)
Center Stone Weight 0.75 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.75 Carat (Approximate)
Dimension(approx) Marquise-4X8 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Marquise
Setting Type Bezel Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
lab-created-blue-sapphire-rings