Certified Lab Grown Diamond Circle of Life Necklace

Sale price £264.00 Regular price £303.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Symbolic Circle of Life Design

The Certified Lab Grown Diamond Circle of Life Necklace is designed around a timeless circular motif. The continuous loop represents unity, continuity, and enduring connection, making it a meaningful piece for personal wear or thoughtful gifting.

Its balanced proportions and refined silhouette allow it to sit gracefully at the neckline, offering subtle brilliance without overwhelming the overall look. This style suits both everyday wear and special occasions.

Circular Pendant Structure

The circle design creates visual harmony, with diamonds arranged to follow the natural curve of the pendant. This arrangement enhances light reflection while maintaining a clean, symmetrical appearance.

The pendant’s form is crafted to remain centered and stable when worn, supporting both comfort and consistent presentation throughout the day.

Lab Grown Diamond Value

This necklace features certified lab grown diamonds created without traditional mining. Their environmental impact varies by production and energy source. Lab grown diamonds share the same core physical and optical properties as mined diamonds, including the durability suited for regular wear.

High-Level Features

The necklace combines a symbolic circular pendant with lab grown diamond detailing for refined brilliance. Its design emphasizes meaning, balance, and versatile styling suitable for layering or standalone wear.

Product Information
SKU SHP-PENDANT022510056
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 1.13 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 1.13 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-12 Pcs
Round-1.40X1.40 mm-24 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More

FAQs About: Lab Grown Diamond Circle Of Life Necklace

What does a Circle of Life necklace symbolize?
The circular design commonly represents continuity, unity, and an unbroken connection, making it a meaningful jewelry motif.
Are lab grown diamonds real diamonds?
Lab grown diamonds have the same fundamental physical and optical properties as mined diamonds, differing only in origin.
Is a diamond circle pendant suitable for everyday wear?
A well-crafted circular pendant with secure stone placement is designed to handle regular daily use while maintaining its structure.
Can a Circle of Life necklace be layered with other chains?
Yes, its balanced circular shape pairs well with both shorter and longer chains for a layered look, depending on personal style preference.
How should a diamond pendant necklace be cleaned?
Gentle cleaning with a soft brush and mild solution helps maintain brilliance, along with periodic inspection of the chain and pendant setting.