Certified Lab Grown Diamond Cross Fish Hook Earrings

Regular price £291.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Design with Modern Elegance

These certified lab grown diamond cross fish hook earrings are designed for those who seek meaningful jewelry with a refined presence. The cross motif introduces symbolic depth, while the clean structure keeps the overall look balanced and wearable.

The result is a piece that feels both personal and polished.

Fish Hook Style for Fluid Movement

The fish hook design allows the earrings to move naturally with the wearer, creating a subtle sense of motion. This movement enhances the light performance of the diamonds without making the design feel heavy.

It also contributes to a lighter feel, making the earrings suitable for extended wear.

Structured Setting with Defined Detail

The setting is crafted to maintain the clarity of the cross design while securely holding each stone in place. Its structure ensures that the form remains consistent, even with movement.

This balance between structure and fluidity defines the overall appeal of the earrings.

Lab Grown Diamonds with Consistent Brilliance

Lab grown diamonds are selected for their consistent clarity and sparkle. They are created without traditional mining, and their environmental impact varies by production and energy source.

This makes them a considered choice for those who value both visual performance and modern sourcing methods.

Versatile Wear for Different Occasions

These earrings transition easily between everyday styling and more formal settings. Their symbolic design adds meaning, while their clean silhouette ensures they remain easy to pair with other pieces.

They can be worn as a standalone statement or integrated into a layered jewelry look.

Product Information
SKU SHP-EARRINGS022510046
Weight 3.56 gm (Approximate)
Total Stone Weight 0.79 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 38 Pieces
Total Weight 0.79 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-4 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-8 Pcs
Round-1.80X1.80 mm-24 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-created-diamond-earrings

Faq About: Certified Lab Grown Diamond Cross Fish Hook Earrings

Are fish hook earrings comfortable for daily wear?
Fish hook earrings are generally lightweight and allow natural movement, making them comfortable for extended wear when secured properly.
What makes the cross design unique in these earrings?
The cross motif adds symbolic meaning while maintaining a clean and refined appearance suitable for modern styling.
Are lab grown diamonds suitable for regular use?
Lab grown diamonds are durable and maintain their brilliance over time, making them suitable for frequent wear with proper care.
Do these earrings feel heavy when worn?
The fish hook design keeps the earrings lightweight, allowing them to feel balanced without putting strain on the ear.
Can these earrings be styled with other jewelry?
Yes, their minimal yet symbolic design allows them to pair easily with other pieces without overwhelming your overall look.
How should I care for these earrings?
Clean them gently and store them separately to help maintain their shine and structure over time.