Certified Lab Grown Diamond Half Bezel Set Open Circle Necklace

Sale price £223.00 Regular price £256.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Modern Symbol with Timeless Meaning

This open circle necklace is designed for those who appreciate subtle symbolism paired with refined design. The circular form represents continuity and connection, making it a meaningful addition to everyday jewelry.

Its clean structure and balanced proportions allow it to be worn effortlessly across different occasions.

Contemporary Half Bezel Design

The half bezel setting offers a modern approach to showcasing the center stone. By partially enclosing the diamond, it provides a secure hold while allowing light to interact naturally with the stone.

This design creates a sleek, minimal aesthetic that feels both current and enduring.

Lab Grown Diamond with Thoughtful Sourcing

The necklace features a lab grown diamond, created without traditional mining. This approach offers an alternative sourcing method, though impact varies by production and energy source.

The result is a stone that delivers a refined appearance suitable for both daily wear and special moments.

Designed for Everyday Comfort

The pendant is crafted to sit naturally along the neckline, ensuring ease of wear throughout the day. Its lightweight structure supports comfort without compromising on visual appeal.

This makes it a versatile piece that transitions seamlessly from casual to formal settings.

Minimal Form with Distinct Presence

The open circle motif combined with the half bezel diamond creates a balanced composition that feels intentional rather than ornate. It is designed to stand out through simplicity rather than excess detail.

This understated approach allows the piece to complement a wide range of personal styles.

A Versatile Gift Choice

With its symbolic design and refined construction, this necklace makes a thoughtful option for gifting. It suits occasions where meaning and wearability are equally important.

The design ensures it remains relevant beyond trends, making it a lasting addition to any jewelry collection.

Product Information
SKU SHP-PENDANT022510067
Weight 3.00 gm (Approximate)
Center Stone Weight 0.48 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 24 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-20 Pcs
Round-2.50X2.50 mm-4 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Half-Bezel-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
lab-grown-diamond-necklace

Faq About: Certified Lab Grown Diamond Half Bezel Set Open Circle Necklace

What does the open circle design symbolize?
The open circle is often associated with continuity, unity, and lasting connection, making it a meaningful jewelry design.
Is the half bezel setting secure?
Yes, the half bezel setting is designed to hold the stone securely while allowing light exposure for a refined appearance.
Can this necklace be worn daily?
The necklace is designed for everyday wear, offering a comfortable fit and a balanced structure suitable for regular use.
What makes lab grown diamonds different?
Lab grown diamonds are created without traditional mining, though their environmental impact can vary depending on production methods and energy sources.
Is this necklace suitable for layering?
Yes, its minimal design makes it easy to pair with other necklaces for a layered look without appearing bulky.
Is this a good gift option?
Its symbolic meaning and versatile design make it a thoughtful choice for gifting on various occasions.