Certified Lab Grown Diamond Infinity Loop Necklace

Sale price £228.00 Regular price £262.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Graceful, symbolic, and softly radiant, this Certified Lab Grown Diamond Infinity Loop Necklace is designed around the promise of love without an ending. The pendant flows into an infinity-inspired loop with ribbon-like curves, giving the piece a gentle sense of movement while round lab grown diamonds add a refined shimmer across the design. It feels meaningful without being overly ornate, making it a thoughtful gift for anniversaries, birthdays, Valentine’s Day, or a personal milestone worth keeping close.

Certified Lab Grown Diamond Infinity Loop Necklace For Her

This lab grown diamond necklace brings together a sculptural infinity silhouette and petite round brilliant diamonds in a pave setting. The design carries 41 white lab grown diamonds with an approximate total weight of 0.18 carat, arranged in varying round sizes to follow the pendant’s flowing curve. With EF-VS quality diamonds and a choice of precious metal options, it offers a polished balance of sparkle, sentiment, and everyday wearability.

What Makes This Special

The necklace is centered on an infinity loop motif, a design loved for its connection to lasting devotion, continuity, and meaningful bonds. Its smooth, ribbon-like structure gives the pendant a graceful profile, while the pave-set diamonds bring light across the curve rather than concentrating sparkle in a single point.

It includes 41 round lab grown diamonds in EF-VS quality, with brilliant cut faceting and a white diamond appearance. The total lab grown diamond weight is approximately 0.18 carat, with individual round diamonds measuring from approximately 0.80 mm to 1.40 mm. The pendant has an approximate weight of 3.80 grams and can be selected with an 18-inch chain or without a chain.

Available metal choices include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, allowing the piece to be chosen in a tone that suits the wearer’s style.

Why Choose This Design

The infinity shape gives this necklace more emotional depth than a simple diamond pendant, while the pave setting keeps the sparkle delicate and refined. Round brilliant lab grown diamonds are a strong choice for this curved design because their shape follows the loop smoothly and their faceting adds a lively play of light across the pendant.

The petite diamond layout makes the necklace easy to wear often, whether styled alone as a meaningful signature piece or layered with a fine chain. Its soft curves keep the design feminine and versatile, while the metal options make it easy to choose a cooler white finish or a warmer yellow gold tone.

Design Meaning

The infinity loop is a symbol of forever love, devotion, and connection that continues beyond a single moment. In this lab diamond necklace, the curved form feels especially personal because it wraps the idea of eternity into a graceful, wearable pendant. It is a heartfelt choice for celebrating a lasting relationship, honoring a promise, or giving someone a daily reminder that they are cherished.

Authenticity & Craftsmanship

Rosec Jewels crafts this necklace with close attention to diamond placement, setting security, and refined finishing so the pendant feels polished from every angle. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, helping ensure that the pave-set lab grown diamonds are presented with care. A Certificate of Authenticity is included with the jewelry for added purchase confidence, and care guidance is provided to help preserve the necklace’s finish and sparkle over time.

Style and Wearability

This infinity loop necklace sits close to the heart, making it easy to style with everyday outfits, office looks, date-night dressing, or special occasion attire. The pendant’s curved profile catches light subtly as it moves, while the diamond accents add brightness without overwhelming the neckline. Choose it with the 18-inch chain for a ready-to-wear gift, or select the pendant without a chain if the wearer already has a preferred necklace length or metal match.

Product Information
SKU SHP-PENDANT022510084
Weight 3.80 gm (Approximate)
Center Stone Weight 0.18 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 41 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-24 Pcs
Round-0.90X0.90 mm-8 Pcs
Round-1.10X1.10 mm-2 Pcs
Round-1.20X1.20 mm-3 Pcs
Round-1.30X1.30 mm-3 Pcs
Round-1.40X1.40 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade EF-VS
View More

FAQs About: Certified Lab Grown Diamond Infinity Loop Necklace

What makes this necklace a meaningful gift?

The infinity loop design represents lasting love, devotion, and an unbroken bond, making it a thoughtful gift for anniversaries, birthdays, Valentine’s Day, or any moment that deserves a personal symbol of affection.

What type of diamonds are used in this necklace?

This necklace is set with 41 round white lab grown diamonds in EF-VS quality. The diamonds have a brilliant cut and an approximate total weight of 0.18 carat.

What setting style is used for the diamonds?

The round lab grown diamonds are arranged in a pave setting, allowing the petite stones to follow the flowing infinity curve and create a soft, continuous sparkle across the pendant.

Which metal options are available for this infinity necklace?

The necklace is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Does this necklace come with a chain?

This design can be selected with an 18-inch chain or without a chain, giving you the flexibility to choose a ready-to-wear option or pair the pendant with an existing chain.

Does the necklace include authenticity documentation?

Yes, Rosec Jewels provides a Certificate of Authenticity with this certified lab grown diamond necklace for added confidence in your purchase.

How should I care for this lab grown diamond infinity necklace?

Store the necklace separately in a soft pouch or jewelry box, avoid harsh chemicals, and clean it gently with a soft cloth. For longer-lasting brilliance, remove it before swimming, heavy exercise, or applying lotions and perfumes.