Certified Lab Grown Diamond Key Necklace For Women

Sale price £276.00 Regular price £317.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

She has the key of your heart, let her know this with a Key Diamond Pendant. This Pendant is in a unique design featuring a three-petal floral motif at the top. This Key Pendant Necklace is embedded with EF-VS Quality Lab Grown Diamonds. This pendant will make her look extra sparkling and make her the center of attention. Stun your lady love with the breathtaking beauty of this Diamond Pendant Necklace. To ensure that your feelings attached to this pendant are secured, we send you this pendant with a premium quality gift box.

Product Information
SKU SHP-PENDANT082310777
Length 35 mm
Width 12 mm
Metal Weight 5.88 gm (Approximate)
Total Stone Weight 0.44 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 55 Pieces
Total Weight 0.44 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-55 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More