Certified Lab Grown Emerald Cut Emerald Engagement Ring with Celtic Knot

Sale price £228.00 Regular price £262.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This certified lab grown emerald cut emerald engagement ring is designed for those who value symbolism as much as style. The clean, elongated lines of the emerald cut center stone create a refined focal point, while the Celtic knot detailing adds depth and meaning to the overall design.

Design & Celtic Knot Setting

The emerald cut is known for its structured facets and understated elegance, allowing the green hue to appear clear and balanced. The Celtic knot motif woven into the setting represents continuity and connection, making this ring especially meaningful as an engagement piece. The design combines architectural precision with intricate craftsmanship.

About Lab Grown Emerald

A lab grown emerald offers the vivid green appearance associated with emerald while being created without traditional mining. As with all gemstones, impact varies by production and energy source. The emerald cut enhances clarity and symmetry, making it well suited for those who appreciate clean lines and strong presence.

Key Highlights

  • Emerald cut center stone: elongated silhouette with structured facets.
  • Lab grown emerald: created without traditional mining.
  • Celtic knot detailing: symbolic design integrated into the setting.
  • Engagement-ready style: distinctive yet timeless aesthetic.
Product Information
SKU SHP-RINGS0821158719
Width 4.5 mm
Height 8 mm
Metal Weight 3.00 gm (Approximate)
Center Stone Weight 1.68 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 1.68 Carat (Approximate)
Dimension(approx) Emerald Cut-6X8 mm-1 Pcs
Color Green
Cut Brilliant
Shape Emerald Cut
Setting Type Other-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Other-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-emerald-rings

FAQs About: Certified Lab Grown Emerald Cut Emerald Engagement Ring with Celtic Knot

What does a Celtic knot design symbolize in an engagement ring?
The Celtic knot is commonly associated with continuity and interconnectedness, making it a meaningful element in engagement jewelry.
Is a lab grown emerald a real emerald?
A lab grown emerald has the same visual characteristics as emerald but is created in a controlled environment rather than mined from the earth.
Is emerald cut suitable for engagement rings?
The emerald cut is valued for its clean lines and balanced proportions, offering a refined and distinctive look for engagement jewelry.
Can this ring be worn daily?
Engagement rings are commonly worn daily. Proper care and mindful wear help maintain the appearance of the gemstone and setting over time.
Who is this ring best suited for?
This ring is ideal for someone seeking a meaningful design that combines structured elegance with symbolic Celtic detailing.