Certified Lab Grown Emerald Diamond Flower Engagement Ring

Regular price £358.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Commemorate your love with a fresh, nature inspired sparkle with this Flower Engagement Ring. Designed to capture hearts, this dreamy design features a 6 mm Round Shape Lab Created Emerald in Prong Setting, placed into a delicate flower motif that symbolizes love, growth and new beginnings. The rich green AAAA Quality Lab Emerald shines with natural beauty, while the surrounding HI-SI Diamond stones add a soft, romantic glow. The Wave style band adds a modern twist, gently curving around the finger and catching the light with every move. Dainty Diamond stones are carefully set along the band, creating a graceful, flowing look that feels both trendy and timeless. This Lab Emerald Diamond Engagement Ring is perfect for the free spirit who loves something unique and meaningful. This Lab Grown Emerald Ring for Engagement is a beautiful way to express your love while staying true to your values. Whether it is for a proposal or a special celebration, this Nature Inspired Engagement Ring is a stunning reminder of your one-of-a-kind bond. Elegant, modern and full of charm, this Lab Emerald Flower Ring is a blooming symbol of forever.

Product Information
SKU SHP-RINGS082218627
Width 5.4 mm
Height 8 mm
Metal Weight 2.70 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-emerald-engagement-rings