Certified Moissanite Floral Engagement Ring For Her

Regular price £232.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Experience the timeless elegance of this exquisite Flower Engagement Ring, featuring a dazzling 4 MM round cut moissanite at its heart. Expertly set in secure prong setting, this centerpiece stone radiates remarkable brilliance and fire, drawing the eye with its captivating sparkle. Surrounding the central moissanite is an intricate floral design crafted from a delicate arrangement of shimmering stones, forming a beautiful blossom that symbolizes love, growth, and new beginnings. Each moissanite in this ring is carefully selected for its exceptional quality, boasting a D color and VS1 clarity. The design gracefully combines classic sophistication with a contemporary floral motif, making it a perfect symbol of romance and individuality. Whether chosen as an engagement ring or a meaningful gift, this Moissanite Engagement Ring is a celebration of beauty, purity, and commitment. Its refined sparkle and elegant craftsmanship make it an heirloom-worthy treasure to cherish for a lifetime. Celebrate your unique love story with this stunning Flower Ring for Women, a harmonious blend of nature's inspiration and enduring elegance, destined to shine bright through all of life's most cherished moments.

Product Information
SKU SHP-RINGS082214541
Metal Weight 2.32 gm (Approximate)
Total Stone Weight 0.85 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 27 Pieces
Total Weight 0.85 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-4 Pcs
Round-1.50X1.50 mm-14 Pcs
Round-4X4 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings