Certified Moissanite Flower Crawler Earring

Regular price £296.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Artful design and a graceful sparkle unite in a Moissanite Crawler Earring, turning ear styling into a statement of elegance. Featuring a delicate flower motif at its center, this Cartilage Earring is thoughtfully enhanced with a combination of marquise and round cut moissanites. Each stone is held securely in prong setting, allowing for exceptional brilliance. Created for versatility, this piece is perfect for helix, upper lobe, or cartilage piercings, adding movement without overpowering your look. The floral detailing brings a romantic touch, while the diverse stone shapes contribute modern sophistication and visual appeal. Completed with a flat back closure, the Flower Helix Earring ensures a secure and comfortable fit, making it ideal for extended wear during special occasions or stylish everyday moments. Perfect for those who value unique body jewelry, this Moissanite Flower Earring pairs beautifully with minimalist studs or layered ear stacks for a chic, fashion-forward aesthetic. You can gift this Moissanite Helix Earring to someone you love, like your daughter, mom, friend, girlfriend, or wife, as a New Years, Birthday, Anniversary, or Christmas Gift. Whether you are dressing up for a special occasion or adding a touch of shine to your everyday outfit, it is a piece that instantly lifts your style.

Product Information
SKU SHP-BODYJ042210031
Metal Weight 0.44 gm (Approximate)
Total Stone Weight 0.30 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 8 Pieces
Total Weight 0.30 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-4 Pcs
Round-1.50X1.50 mm-2 Pcs
Round-1.80X1.80 mm-1 Pcs
Round-2X2 mm-1 Pcs
Color White
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
helix-earrings