Certified Moissanite Heart Curved Crawler Earring

Regular price £340.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add a touch romance and sparkle to your style with this beautiful Moissanite Heart Climber Earring. Designed with a graceful curve, the earring features a row of delicate heart shapes that gently climb along the ear, creating a stylish and eye-catching look. Each heart motif is adorned with round cut moissanite stones set in a pave setting, giving the piece a classic yet dazzling sparkle. The curved design follows the natural shape of the ear, making this Moissanite Crawler Earring perfect for helix, cartilage, or upper lobe piercings. It sits comfortably while adding a unique and modern touch to your ear stack. The flat back closure keeps the Heart Helix Earring secure and comfortable, so you can wear it with confidence throughout the day. This Curved Cartilage Earring is easy to style and works beautifully with both casual outfits and special occasion looks. Whether you are heading out with friends, attending a celebration, or simply adding a little sparkle to your everyday style, it brings a charming and elegant feel. It also arrives in a signature jewelry box with a certificate of authenticity, making it a thoughtful and ready-to-gift piece for someone special.

Product Information
SKU SHP-BODYJ022210458
Metal Weight 0.80 gm (Approximate)
Total Stone Weight 0.22 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 15 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-15 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
cartilage-earrings