Certified Moissanite Heart Infinity Jewelry Set

Sale price £223.00 Regular price £256.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Set Designed for Connection

This certified moissanite heart infinity jewelry set is created for those who value symbolism as much as style. The combination of heart and infinity motifs reflects lasting connection, making it a thoughtful choice for gifting or personal keepsakes.

It offers a coordinated look that feels intentional without being overly ornate.

Unified Design Across Every Piece

Each element within the set is designed to complement the others, creating visual harmony when worn together. The heart form introduces softness, while the infinity detail adds structure and continuity.

This balance allows the set to feel cohesive while still maintaining individual character in each piece.

Setting that Enhances Symbolic Detail

The setting is carefully crafted to hold each stone securely while preserving the clarity of the design. It supports both the visual flow of the motifs and the light performance of the stones.

This ensures that the design remains defined and wearable across different occasions.

Moissanite for Lasting Brilliance

Moissanite is chosen for its consistent sparkle and durability, making it suitable for regular wear. It is created without traditional mining, and its environmental impact varies by production and energy source.

Its light performance enhances both the symbolic and visual appeal of the set.

Versatility in Coordinated Styling

The set can be worn together for a complete look or styled separately for a more minimal approach. This flexibility allows it to adapt across different outfits and occasions.

It is well-suited for those who prefer jewelry that offers both meaning and adaptability.

Product Information
SKU SHP-PENDANT032214264
Weight 4.80 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 58 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-28 Pcs
Round-0.90X0.90 mm-18 Pcs
Round-1X1 mm-12 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
heart-necklaces

Faq About: Certified Moissanite Heart Infinity Jewelry Set

What does the heart infinity design represent?
The heart symbolizes affection while the infinity motif represents continuity, together expressing lasting connection and meaning.
Is this jewelry set suitable for gifting?
Yes, the symbolic design and coordinated pieces make it a thoughtful option for occasions like anniversaries, birthdays, or personal milestones.
Can the pieces be worn separately?
The pieces are designed to work together as a set but can also be styled individually for a more minimal look.
Is moissanite suitable for everyday wear?
Moissanite is known for its durability and can be worn regularly when handled with appropriate care.
Does the set feel too bold for daily use?
The design balances symbolism with simplicity, allowing it to remain wearable without appearing overly bold.
How should I maintain this jewelry set?
Regular gentle cleaning and proper storage help maintain the brilliance and finish of each piece over time.