Certified Moissanite Infinity Pendant Necklace for Women

Regular price £847.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K White Gold
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Symbolizing endless love and timeless elegance, this Infinity Pendant Necklace is a stunning addition to any jewelry collection. At the center of the Infinity Knot rests a brilliant 4 mm Round Shape Moissanite set in Prong Setting, catching light beautifully with every movement. Surrounding the center stone, the Infinity loop is adorned with Moissanite, adding sparkle without overwhelming the design. Handcrafted with perfection, this Love Knot Necklace balances sophistication and subtle charm, making it perfect for both everyday wear and special occasions. Its versatile design allows it to pair effortlessly with casual outfits, work attire or elegant evening dresses. Whether you are gifting it to someone special or treating yourself, the necklace comes in a signature jewelry box, ready to delight right out of the package. The infinity motif is a meaningful symbol of eternal connection, making this Moissanite Pendant Necklace a thoughtful gift for anniversaries, birthdays or milestones that celebrate love and friendship. With its sparkling D-VS1 Quality Moissanite stones and elegant design, this Moissanite Diamond Necklace transforms any outfit, adding a touch of sparkle and sentiment. Make every moment shine with a piece that speaks to both heart and style.

Product Information
SKU SHP-PENDANT052310102
Length 19.7 mm
Width 10 mm
Metal Weight 4.60 gm (Approximate)
Total Stone Weight 0.41 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 26 Pieces
Total Weight 0.41 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-1 Pcs
Round-1X1 mm-24 Pcs
Round-4X4 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces