Certified Moissanite Solitaire Infinity Pendant and Earrings Set

Sale price £229.00 Regular price £263.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Celebrate connection with a coordinated design built around the infinity symbol. This Certified Moissanite Solitaire Infinity Jewelry Set pairs an infinity pendant with matching stud earrings, each centered with a brilliant white round moissanite. The flowing motif and three-stone arrangement make the set especially suited to anniversaries, birthdays, romantic gifting, and milestones that represent a lasting bond.

1.62 Carat Moissanite Infinity Necklace and Earrings Set

The set contains three round brilliant-cut white moissanites with a combined approximate weight of 1.62 carats. A 6 x 6 mm moissanite forms the solitaire focal point of the infinity pendant, while each coordinating stud earring holds a 4 x 4 mm round stone. All three moissanites are D-VS1 quality and secured in 3-prong settings. The confirmed set is crafted in 92.5 sterling silver with an approximate metal weight of 4.50 grams, while the pendant measures about 17.5 mm long and 9.5 mm wide.

What Makes This Moissanite Infinity Jewelry Set Special

  • Matching infinity pendant and stud earrings for coordinated styling.
  • Three round white moissanites totaling approximately 1.62 carats.
  • One 6 x 6 mm round moissanite creates the pendant's central focus.
  • Two 4 x 4 mm round moissanites complete the matching stud earrings.
  • D-VS1 quality with brilliant-cut faceting.
  • Each moissanite is secured in a 3-prong setting.
  • Flowing infinity motifs frame the solitaire stones.
  • Crafted in confirmed in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K .

Meaning Behind the Moissanite Solitaire Infinity Design

The infinity motif is associated with continuity, connection, and bonds without an end, giving this matching jewelry set natural significance for romantic and personal gifting. Placing a single round moissanite within each infinity design keeps the symbolism clear while creating a bright focal point. Worn together, the pendant and earrings form a coordinated expression of lasting connection; worn separately, each piece carries the same meaning in a more understated way.

Certified Moissanite Jewelry Authenticity & Craftsmanship

Rosec Jewels crafts its moissanite jewelry with attention to stone placement, secure settings, and refined finishing. A Certificate of Authenticity is offered with Rosec Jewels jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to help preserve the moissanite brilliance and sterling silver finish.

Styling the Moissanite Infinity Necklace and Earrings Set

Wear the infinity pendant and matching studs together for a coordinated jewelry look or style each piece separately when a lighter touch of sparkle is preferred. The white round moissanites and sterling silver setting pair naturally with other cool-toned jewelry, while the symbolic infinity design makes the set especially fitting for anniversaries, birthdays, romantic celebrations, and meaningful gifts.

Product Information
SKU SHP-PENDANT042168537
Length 17.5 mm
Width 9.5 mm
Metal Weight 4.50 gm (Approximate)
Total Stone Weight 1.62 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 3 Pieces
Total Weight 1.62 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Round-4X4 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type 3-Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: Certified Moissanite Solitaire Infinity Jewelry Set

What pieces are included in this moissanite infinity jewelry set?

The set includes an infinity pendant and a pair of matching stud earrings. Each piece features one round white moissanite positioned within the flowing infinity-inspired design.

What size are the moissanite stones in the pendant and earrings?

The pendant features one round moissanite measuring approximately 6 x 6 mm, while each stud earring contains one round moissanite measuring approximately 4 x 4 mm.

What is the total moissanite weight and quality of this jewelry set?

The three round moissanites have an approximate combined weight of 1.62 carats. They are white, brilliant cut, graded D-VS1 quality, and secured in 3-prong settings.

What does the infinity design symbolize?

The infinity motif is commonly associated with lasting connection, continuity, and enduring bonds. This symbolism makes the matching moissanite set particularly suitable for anniversaries, romantic gifting, birthdays, and meaningful relationship milestones.

What metal is used for this moissanite necklace and earrings set?

The confirmed jewelry set is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate combined metal weight of 4.50 grams.

Does this certified moissanite jewelry set come with a Certificate of Authenticity?

Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Pieces also go through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for a moissanite infinity jewelry set?

Clean the jewelry gently with mild soap, lukewarm water, and a soft cloth or brush, then dry it carefully. Avoid harsh chemicals and strong impact, store the pieces separately when not worn, and periodically check the prong settings to help maintain secure wear.