Certified Natural Diamond Flower Engagement Ring

Regular price £593.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Celebrate the magic of love with this Flower Engagement Ring, where elegance meets romance most delicately. At the center of the design, a beautiful Flower motif blossoms with sparkling Round Shape Diamond stones of HI-SI Quality, each carefully placed to catch the light and shimmer with every movement. Its graceful, feminine design captures the joy and beauty of a love that grows with each passing day, making it perfect for the moment you say forever. The timeless charm of this Diamond Flower Ring is complemented by a signature jewelry box and a range of sizes, ensuring that this piece becomes a cherished symbol of your devotion, ready to be treasured for a lifetime. Simple yet stunning, this Statement Ring blends classic sophistication with a modern style, allowing her to feel special not just on a big day but every day. This Nature Inspired Engagement Ring turns a single gesture into a lifelong memory, radiating beauty, joy and a love that blooms endlessly.

Product Information
SKU SHP-RINGS032012625
Width 13 mm
Height 6.3 mm
Metal Weight 2.39 gm (Approximate)
Total Stone Weight 0.67 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 17 Pieces
Total Weight 0.67 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-8 Pcs
Round-2.40X2.40 mm-1 Pcs
Round-2X2 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
cocktail-rings