Certified Natural Garnet Rose Flower Engagement Ring with Diamond

Sale price £246.00 Regular price £277.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Capture attention and hearts alike with this Flower Engagement Ring, a truly romantic piece inspired by the beauty of nature. At its center, a vibrant 4 mm Round Shape Garnet is set in a flower, radiating deep, passionate red that symbolizes love and devotion. The nature inspired band is delicately studded with sparkling Diamond stones, adding shimmer and elegance while enhancing the floral motif. Crafted to perfection and available in various sizes, this Garnet Diamond Ring promises a flawless fit, making it the perfect symbol of a lifelong commitment. Presented in a signature jewelry box, this Garnet Engagement Ring is ready to gift, turning proposals, anniversaries or special celebrations into unforgettable moments. The intricate design blends modern sophistication with timeless charm, making it a ring that is as meaningful as it is stunning. Whether paired with elegant evening attire or cherished as a daily reminder of love, this Red Garnet Ring captures the essence of romance in every detail. A sparkling testament to enduring love and a treasured piece that will be adored for a lifetime.

Product Information
SKU SHP-RINGS0821187965
Width 6 mm
Height 8 mm
Metal Weight 3.60 gm (Approximate)
Total Stone Weight 0.48 Carat (Approximate)
GARNET INFORMATION
No.of Stones 1 Pieces
Total Weight 0.34 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
garnet-engagement-rings