Certified Real Citrine Flower Engagement Ring with Diamond

Regular price £358.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Express your deepest emotions with this Flower Engagement Ring, a delicate masterpiece where nature and romance bloom together. At its center, a radiant 5mm Round Shape Citrine rests in a rose shaped flower motif, its golden glow capturing warmth, joy and the promise of forever. Surrounding it, Diamond stones trace the curves of the band, adding subtle sparkle and a touch of elegance that makes every angle shine. The gracefully curved band enhances the floral design, creating a sense of movement. Thoughtfully crafted and available in multiple sizes, this Citrine and Diamond Ring ensures a perfect fit for the one who holds your heart. Housed in a signature jewelry box, the moment of gifting becomes unforgettable. This Citrine Engagement Ring is a symbol of devotion, a vow and a memory to cherish for a lifetime. This Nature Inspired Engagement Ring captures the essence of love in bloom, radiating the eternal promise of togetherness.

Product Information
SKU SHP-RINGS0821183027
Width 5.4 mm
Height 8 mm
Metal Weight 2.70 gm (Approximate)
Center Stone Weight 0.51 Carat (Approximate)
CITRINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Yellow
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
citrine-engagement-rings