Classic Diamond Hoop Earrings with Certificate

Sale price £434.00 Regular price £499.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Timeless Hoops with Defined Brilliance

These classic diamond hoop earrings are designed for those who appreciate enduring style with measurable quality. The continuous circular silhouette frames the face with light, offering a refined look that transitions seamlessly from daily wear to formal occasions.

With certified diamonds, this pair is suited for buyers who value documented authenticity alongside visual elegance.

Structured Hoop Architecture

The hoop form creates a balanced, uninterrupted line around the ear. Each diamond is set to follow the curve precisely, allowing consistent spacing and alignment that supports both symmetry and security.

This structured design ensures the earrings maintain their circular integrity while delivering steady brilliance along the front-facing arc.

Light Behavior: Continuous Edge Sparkle

The arrangement of diamonds along the hoop produces a flowing band of reflection. As the earrings move, light travels across the surface in a continuous sequence rather than a single focal flash.

This creates an elegant edge sparkle that enhances visibility without appearing excessive.

Crafted for Everyday and Occasion Wear

Diamond hoops are a foundational jewelry piece, suitable for both minimal styling and layered combinations with studs or ear cuffs. Their classic profile makes them adaptable to evolving wardrobes and personal aesthetics.

The certified nature of the diamonds adds confidence in quality while maintaining a clean, timeless appearance.

Product Information
SKU SHP-EARRINGS032230491
Length 15 mm
Width 2 mm
Height 13 mm
Metal Weight 1.90 gm (Approximate)
Total Stone Weight 0.52 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 42 Pieces
Total Weight 0.52 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-42 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-earrings

FAQs About: Classic Diamond Hoop Earrings with Certificate

Are these diamond hoop earrings sold as a pair?
Please refer to the product detail table to confirm whether the listing includes a pair, as packaging details are specified there.
What does the certificate include?
The certificate verifies the authenticity and grading details of the diamonds as described in the product specifications.
Are diamond hoops suitable for daily wear?
Diamond hoops are commonly chosen for everyday wear due to their secure settings and balanced design. Proper care helps maintain their finish over time.
How should I clean diamond hoop earrings?
Clean gently using mild soap and lukewarm water, then dry with a soft cloth. Avoid abrasive cleaners to preserve both the metal and diamond surfaces.
Can these hoops be styled with other earrings?
Yes, classic diamond hoops pair well with studs, cartilage pieces, or minimalist accents for layered ear styling.