Designer Emerald Crossover Engagement Ring with Diamond

Sale price £715.00 Regular price £786.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Bring a touch of gemstone brilliance to your look with this Emerald Engagement Ring, a symbol of elegance and renewal perfect for those born in May. The Crossover Ring features a 5 MM round shaped emerald set gracefully in secure prong setting. Its unique design showcases a crossover shank adorned with sparkling diamonds, adding a refined and designer touch that makes this piece truly special. Beneath the emerald lies a delicate diamond set in a flower motif, creating a hidden surprise that adds charm and detail to the Designer Engagement Ring. The combination of the AAA quality emerald and shimmering HI-SI quality diamonds gives the piece a luxurious yet graceful feel, perfect for anyone who values timeless beauty with a modern twist. The crisscross design beautifully symbolizes connection and harmony, making it a meaningful choice for engagements or special celebrations. This Emerald and Diamond Ring is not just jewelry but a statement of personality and style. Whether worn every day or for memorable occasions, it adds a hint of sophistication and color to any outfit.

Product Information
SKU SHP-RINGS0821184781
Width 6.5 mm
Height 8.5 mm
Metal Weight 2.70 gm (Approximate)
Total Stone Weight 0.90 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 58 Pieces
Total Weight 0.40 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-8 Pcs
Round-0.90X0.90 mm-8 Pcs
Round-1X1 mm-40 Pcs
Round-2X2 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
engagement-ring