Designer Moissanite Bar Drop Necklace in Pave Setting

Sale price £211.00 Regular price £243.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Modern Bar Drop Necklace with Refined Sparkle

The 3/4 CT Designer Moissanite Bar Drop Necklace in Pave Setting presents a contemporary interpretation of diamond-inspired jewelry. Its vertical bar silhouette introduces a clean and structured look while the moissanite stones add brilliance that enhances the pendant’s visual presence.

This necklace is suited for those who prefer jewelry with a modern edge and balanced proportions. The elongated drop design draws the eye naturally toward the pendant, creating a refined focal point at the neckline that works well with both casual and formal styling.

Why the Bar Drop Design Stands Out

Bar drop necklaces are valued for their sleek geometry and contemporary simplicity. The vertical structure creates a subtle lengthening effect at the neckline, which contributes to the elegant appearance of the pendant while maintaining a minimal overall design.

In this style, the pave arrangement of stones helps amplify the brightness of the pendant. Multiple small stones are positioned closely together along the bar, allowing light to reflect from different angles and creating a continuous line of sparkle.

The Appeal of Moissanite in Fine Jewelry

Moissanite is widely appreciated for its exceptional brilliance and ability to reflect light. Because of its optical performance, it is often selected for designs where sparkle and clarity are important visual elements.

Moissanite gemstones are created without traditional mining, though environmental impact can vary depending on production methods and energy sources. Their durability and brilliance make them a practical choice for jewelry pieces that are intended for regular wear.

High-Level Features of the Necklace

The necklace combines a structured pendant silhouette with a refined pave setting, allowing the stones to form a continuous luminous surface along the bar. This arrangement keeps the design visually balanced while ensuring the pendant remains the focal point.

Its modern form makes it versatile for different styling approaches. The necklace can be worn alone for a clean and polished look or layered with other delicate chains to create a contemporary stacked jewelry style.

Product Information
SKU SHP-PENDANT032213987
Metal Weight 3.20 gm (Approximate)
Total Stone Weight 0.87 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 36 Pieces
Total Weight 0.87 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-29 Pcs
Round-1.30X1.30 mm-3 Pcs
Round-1.20X1.20 mm-2 Pcs
Round-1.10X1.10 mm-2 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: 3/4 CT Designer Moissanite Bar Drop Necklace in Pave Setting

What is a bar drop necklace?
A bar drop necklace features a vertically aligned pendant shaped like a slim bar that hangs from the chain. This design creates a modern and streamlined appearance while drawing attention to the center pendant.
What does a pave setting mean in jewelry?
A pave setting involves placing small gemstones closely together so that very little metal is visible between them. This technique creates a continuous surface of sparkle across the jewelry piece.
Is moissanite suitable for everyday jewelry?
Moissanite is known for its durability and strong brilliance, which makes it a popular choice for jewelry intended for regular wear. With proper care, moissanite pieces can maintain their sparkle over time.
Can this necklace be layered with other chains?
Yes. The slim vertical pendant works well in layered styling because it adds a focal point without overwhelming other necklaces of varying lengths.
How should a moissanite necklace be cleaned?
Moissanite jewelry can typically be cleaned using warm water, mild soap, and a soft brush to remove residue. Gently drying the piece with a soft cloth helps restore its shine.
Who is this necklace best suited for?
This necklace is well suited for someone who prefers modern jewelry with clean lines and noticeable sparkle. The bar drop design makes it a versatile piece for both everyday wear and special occasions.