Diamond Octopus Earring with Flat Back

Regular price £351.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Designed for piercing jewelry lovers who want something imaginative and refined, this diamond octopus earring brings ocean-inspired charm to a curated ear. Round diamonds are set across the octopus shape, giving the tiny sea creature silhouette a soft trail of sparkle while keeping the design compact enough for cartilage, helix, or upper lobe styling. Sold singly, it is a playful yet polished piece for birthdays, friendship gifting, celebrations, or a personal jewelry update with personality.

Round Brilliant Pave Set Diamond's Octopus Earring with Flat Back

This diamond octopus earring is crafted with 30 round brilliant diamonds in a pave setting, creating an approximate total diamond weight of 0.15 carat. The diamonds are HI in color and SI in quality grade, with lab diamond EF-VS and natural diamond HI-SI gemstone quality options available. Finished with a flat back closure, multiple post length choices, and precious gold metal options, it brings a distinctive sea-inspired accent to modern body jewelry styling.

What Makes This Special

The design features 30 round diamonds with an approximate total weight of 0.15 carat. The diamond layout includes 10 round stones measuring approximately 0.80 x 0.80 mm, 5 round stones measuring approximately 0.90 x 0.90 mm, 1 round stone measuring approximately 1.10 x 1.10 mm, and 14 round stones measuring approximately 1 x 1 mm.

The diamonds are round in shape, brilliant cut, HI color, SI quality grade, and arranged in a pave setting across the octopus form. This setting style gives the design a fine, continuous shimmer while preserving the playful outline of the sea creature motif.

The earring has an approximate metal weight of 0.78 gm and is sold singly. Metal options include 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm, with left ear and right ear selections available.

Why Choose This Design

The octopus motif gives this earring a unique identity compared with standard studs or simple diamond flat backs. Its sea-inspired shape feels expressive and unexpected, while the pave-set diamonds keep the look polished and jewelry-forward rather than costume-like.

The flat back closure makes it well suited for cartilage, helix, and upper lobe piercings where comfort and a smooth fit matter. Because it is sold as a single piece, it also works beautifully for asymmetric styling, letting the wearer create a curated ear that feels personal and intentional.

Design Meaning

The octopus is often associated with adaptability, intelligence, mystery, and creative strength. In this diamond earring, the motif becomes a small symbol of confidence and individuality, perfect for someone drawn to ocean-inspired jewelry or meaningful pieces with a playful edge. The diamond sparkle adds a refined contrast to the whimsical form, making the design feel both spirited and special.

Authenticity & Craftsmanship

Each earring is carefully crafted with attention to diamond placement, pave setting security, octopus detailing, smooth flat back finishing, and comfortable proportions. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready for styling or gifting. For lasting care, store it separately, avoid harsh chemicals, and wipe it gently with a soft cloth after wear.

Style and Wearability

This diamond octopus earring adds character to helix, cartilage, and upper lobe styling without overwhelming the ear. Worn alone, it becomes a tiny ocean-inspired statement; paired with diamond studs, gold hoops, flat backs, or other marine and celestial motifs, it helps build a curated ear with depth and charm. Its gold options make it easy to coordinate with warm or cool jewelry stacks, while the flat back design supports comfortable everyday styling.

Product Information
SKU SHP-BODYJ052310041
Metal Weight 0.78 gm (Approximate)
Total Stone Weight 0.15 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 30 Pieces
Total Weight 0.15 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-10 Pcs
Round-0.90X0.90 mm-5 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1X1 mm-14 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

FAQs About: Diamond Octopus Earring with Flat Back

What makes this diamond octopus earring unique?

The earring features an octopus-inspired shape accented with pave-set round diamonds. Its sea creature motif gives it a playful, distinctive look, while the diamond detailing keeps the design refined for curated ear styling.

How many diamonds are used in this earring?

The earring includes 30 round diamonds with an approximate total weight of 0.15 carat. The stones are arranged across the octopus shape to create a fine, sparkling finish.

What cut, color, and quality are listed for the diamonds?

The diamonds are round in shape with brilliant cut faceting. They are listed as HI color and SI quality grade, with gemstone quality selections available in lab diamond EF-VS and natural diamond HI-SI.

What setting style is used for the diamonds?

The diamonds are secured in a pave setting. This setting style places the small stones closely across the octopus motif, creating a smooth line of sparkle while keeping the shape detailed.

Is this earring sold as a single piece or a pair?

This earring is sold singly. Left ear and right ear selections are available, making it easy to style one piercing or create an asymmetric curated ear look.

What metal and post length options are available?

The earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold. Flat back post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm.

How should I care for this diamond octopus flat back earring?

Store the earring separately to help prevent scratches, avoid harsh chemicals, and wipe it gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry it carefully before storing.