Enamel Evil Eye Stud Earrings for Women

Sale price £185.00 Regular price £207.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Protective style and everyday charm come together in these Evil Eye Stud Earrings, designed to bring both meaning and beauty to your jewelry collection. Each earring features a carefully enameled evil eye symbol, widely known for representing protection, positivity, and good energy. Wearing evil eye jewelry is believed to help guard against negativity, making these Nazar Earrings a thoughtful and meaningful choice for daily wear. The eye motif is bordered with delicate beaded detailing, adding texture and a handcrafted feel. Crafted from high-quality metal, these Enamel Eye Earrings are durable, lightweight, and comfortable enough to wear all day. Secure screw back closures ensure the Evil Eye Earrings stay firmly in place, giving you confidence and comfort throughout the day. Easy to style and full of symbolism, these earrings fit effortlessly into any jewelry collection.

View More

Product Information
SKU SHP-EARRINGS122045599
Weight 2.25 gm (Approximate)
Product Parent Collection Handle
evil-eye-jewelry