Exquisite Diamond Star Drop Earring for Helix Piercing

Regular price £372.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Made for the piercing stack that loves a little celestial charm, this Exquisite Diamond Star Drop Earring brings a sparkling star-kissed accent to the helix, cartilage, or upper lobe. A polished gold star rests above a natural round diamond drop, creating movement, light, and a playful festive feel in one refined single earring.

Its petite scale keeps the look delicate, while the diamond drop adds just enough brilliance to make it feel meaningful for birthdays, holidays, personal milestones, or a thoughtful jewelry gift for someone who loves expressive ear styling.

Natural Diamond Star Helix Ear Piercing With Flat Back Closure

This celestial helix earring is crafted in gold and detailed with one natural round cut diamond of approximately 0.09 carat. The diamond measures approximately 2.40 x 2.40 mm and is secured in a prong setting beneath the star motif, giving the design a graceful drop silhouette with a clean, luminous finish. Available in 10K, 14K, and 18K yellow or white gold, it can be selected for the left or right ear with flat back post length options for a more personalized fit.

What Makes This Special

  • Single star drop earring designed for helix, cartilage, or upper lobe piercing.
  • Set with 1 natural round brilliant cut diamond in a prong setting.
  • Approximate diamond weight is 0.09 carat with HI color and SI quality grade.
  • Approximate diamond dimension is 2.40 x 2.40 mm.
  • Crafted in gold with metal choices in 10K, 14K, and 18K yellow or white gold.
  • Flat back closure supports a secure, comfortable piercing style.
  • Post length options include 4.5 mm, 5.0 mm, 5.5 mm, 6.0 mm, 6.5 mm, 7.0 mm, and 7.5 mm.
  • Approximate product weight is 0.63 gm.
  • Sold singly for curated ear styling.

Why Choose This Design

The star and diamond drop pairing gives this helix earring more dimension than a simple stud while still keeping the look refined and easy to wear. The round brilliant cut is chosen for lively sparkle, and the prong setting allows the diamond to catch light clearly from the lower drop position. A flat back closure makes the piece suitable for cartilage-focused styling, while left and right ear options help the design sit with intention in a curated piercing arrangement.

Design Meaning

A star motif often carries the feeling of hope, guidance, celebration, and self-expression. Paired with a natural diamond drop, this earring becomes more than a decorative accent; it feels like a small reminder of light, direction, and personal sparkle. It is a meaningful choice for someone building a signature ear stack or gifting a piece that feels bright, personal, and symbolic.

Authenticity & Craftsmanship

Rosec Jewels crafts this diamond star drop earring with careful attention to proportion, stone security, and finishing. The diamond is inspected for its stated quality details, the prong setting is reviewed for secure placement, and the final finish is checked before dispatch. Rosec Jewels offers a Certificate of Authenticity with the piece, along with care guidance to help preserve the shine of the metal and the brilliance of the diamond over time.

Style and Wearability

This single helix earring brings a soft celestial accent to everyday looks, party styling, and curated piercing combinations. Wear it as a standout detail on the helix, add it to a cartilage stack, or place it on the upper lobe for a delicate drop effect. The gold star gives it a warm decorative presence, while the diamond drop keeps the finish polished enough for both casual outfits and special occasions.

Product Information
SKU SHP-BODYJ082210049
Weight 0.63 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.09 Carat (Approximate)
Dimension(approx) Round-2.40X2.40 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Exquisite Diamond Star Drop Earring for Helix Piercing

What type of piercing is this diamond star drop earring designed for?

This single earring is designed for helix, cartilage, and upper lobe piercings. Its flat back closure makes it a secure choice for piercing placements where comfort and a neat back profile matter.

What diamond details are included in this helix earring?

The design includes 1 natural round brilliant cut diamond with an approximate total weight of 0.09 carat. The diamond measures approximately 2.40 x 2.40 mm and has HI color with SI quality grade.

How is the diamond set in the star drop earring?

The round diamond is secured in a prong setting beneath the gold star motif. This setting style helps hold the diamond in place while allowing light to reach the stone for a brighter drop effect.

Which metal options are available for this earring?

This earring is available in 10K yellow gold, 10K white gold, 14K yellow gold, 14K white gold, 18K yellow gold, and 18K white gold.

Is this earring sold as a pair or a single piece?

This design is sold singly, making it ideal for a curated ear stack, a single helix piercing, or a mismatched styling look. You can select the left or right ear option when choosing the piece.

Does this diamond helix earring come with an authenticity certificate?

Yes. Rosec Jewels offers a Certificate of Authenticity with this diamond earring, supporting the confidence in purchase along with quality checks for the stone, setting security, and finish before dispatch.

How should I care for this diamond star drop earring?

Keep the earring away from harsh chemicals, perfumes, and abrasive surfaces. Clean it gently with a soft cloth, store it separately when not in use, and check the flat back closure and prong setting periodically to maintain secure wear.