Exquisite Moissanite Flower Inspired Crawler Earring

Sale price £313.00 Regular price £359.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make a stunning fashion statement with our mesmerizing Ear Crawler Earring featuring a beautiful curved floral design adorned with Round Cut Moissanite in Prong Setting. This Flower Earring is delicately crafted from Metal, giving it a shiny appearance and making this earring suitable for Cartilage, Helix, or Upper Lobe Piercings. Flaunt this Moissanite Climber Earring with your special attire and raise your fashion bar high in the sky. A flat back closure ensures that this Floral Crawler Earring remains comfortable and securely in place, even during extended wear. Its lightweight design and snug fit make it ideal for both daily use and special events. Dazzling D-VS1 quality moissanite stones provide a luxurious shimmer that instantly elevates your look. The floral motif adds a romantic touch, while the contemporary climber style introduces a fashionable element. Whether given as a thoughtful gift or worn as a cherished personal accessory, the Moissanite Helix Earring beautifully combines elegance, brilliance, and comfort in a stunning piece of jewelry.

Product Information
SKU SHP-BODYJ052310028
Length 17.6 mm
Width 7.8 mm
Height 1.5 mm
Metal Weight 0.80 gm (Approximate)
Total Stone Weight 0.73 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 35 Pieces
Total Weight 0.73 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-12 Pcs
Round-1.20X1.20 mm-2 Pcs
Round-1.40X1.40 mm-12 Pcs
Round-1.50X1.50 mm-2 Pcs
Round-1.70X1.70 mm-6 Pcs
Round-1.90X1.90 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
cartilage-earrings