Genuine Diamond Heart Arrow Earring for Helix Piercing

Sale price £276.00 Regular price £304.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Playful Design with Meaningful Detail

This diamond heart arrow helix earring is designed for those who appreciate expressive, symbolic jewelry in a refined form. The heart and arrow motif introduces a subtle sense of personality, making it a distinctive addition to curated ear styling.

Its compact design makes it suitable for everyday wear while maintaining a unique visual identity.

Heart and Arrow Motif with Secure Setting

The combination of heart and arrow elements creates a balanced and recognizable design, offering both visual interest and symbolic appeal. The setting is structured to hold the diamond securely while maintaining a smooth and polished finish.

This design supports comfortable wear, especially in helix placements where a secure fit is essential.

Diamond Accent with Subtle Brilliance

The diamond adds a refined touch of sparkle, enhancing the overall design without overwhelming its minimal structure. Its placement allows it to catch light naturally, creating a balanced and elegant effect.

The simplicity of the design makes it suitable for both standalone wear and layered styling.

Designed for Everyday Comfort

Crafted with attention to wearability, this helix earring is designed to sit comfortably while maintaining a secure fit. Its smooth structure minimizes interference with daily activities.

It pairs easily with other earrings, making it ideal for building a personalized ear stack.

Product Information
SKU SHP-BODYJ022210131
Length 6.8 mm
Width 2.7 mm
Height 1.7 mm
Weight 0.45 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 3 Pieces
Total Weight 0.04 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-3 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Other-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Unique Diamond Gold Heart Arrow Earring for Helix Piercing

Is this earring suitable for helix piercings?
Yes, it is designed specifically for helix placement, offering a secure and comfortable fit.
What does the heart and arrow design represent?
The heart and arrow motif is often associated with love and direction, adding symbolic meaning to the design.
Can this earring be worn daily?
Yes, its secure and minimal design makes it suitable for everyday wear with proper care.
Is this sold as a single earring or a pair?
Please refer to the product details table for accurate information about whether it is sold individually or as a pair.
Can it be styled with other earrings?
Yes, it pairs well with other earrings, making it ideal for curated ear styling.
How should this earring be cared for?
Clean gently with a soft cloth, avoid harsh chemicals, and store it separately to maintain its finish.