Genuine Diamond Open Heart Earring for Helix Piercing

Regular price £352.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Delicate Heart Diamond Earring for Helix Piercing

This Cute Diamond Gold Heart Earring is designed specifically for helix piercings, offering a refined piece of jewelry that complements modern ear styling. The small heart motif creates a charming silhouette while maintaining a clean and minimal aesthetic suitable for cartilage placement.

A diamond accent introduces subtle brilliance to the design, adding a touch of sparkle without overwhelming the delicate structure of the earring. Its compact form allows it to sit neatly along the helix, making it a stylish addition to curated ear looks.

Heart Motif with Elegant Simplicity

The heart shape brings a symbolic and expressive element to the design. Known for representing affection and sentiment, this motif transforms a small cartilage earring into a piece that feels both meaningful and stylish.

The clean outline of the heart ensures the design remains versatile and easy to pair with other earrings, allowing it to blend seamlessly into layered ear arrangements.

Diamond Accent for Subtle Sparkle

Diamonds are admired for their brilliance and timeless presence in fine jewelry. The small diamond incorporated into this design introduces a refined sparkle that enhances the heart motif without distracting from its delicate appearance.

This balance between gemstone brilliance and minimalist design allows the earring to maintain an elegant yet understated look.

Designed for Curated Ear Styling

Helix earrings are often chosen to create layered ear combinations that reflect personal style. Smaller decorative pieces such as heart studs work well when paired with hoops, studs, or other cartilage jewelry.

With its delicate design and symbolic heart shape, this diamond helix earring offers a graceful accessory that can complement a variety of ear styling combinations.

Product Information
SKU SHP-BODYJ052210170
Weight 0.54 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 7 Pieces
Total Weight 0.09 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-7 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade SI
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Genuine Diamond Open Heart Earring for Helix Piercing

What is a helix piercing?
A helix piercing is located along the upper outer cartilage of the ear. It is commonly styled with small studs, hoops, or decorative earrings designed specifically for cartilage placement.
Can a heart earring be worn in a helix piercing?
Yes, small decorative shapes such as hearts are often used in helix jewelry because they provide a stylish detail while remaining comfortable for cartilage piercings.
Why are diamond accents used in cartilage earrings?
Diamond accents add subtle sparkle to small earrings, allowing them to stand out while maintaining a refined and minimalist design.
Can helix earrings be worn with other earrings?
Yes, helix earrings are commonly combined with other ear jewelry such as studs, hoops, or drop earrings to create layered ear styling.
Is a heart earring suitable as a gift?
Heart-shaped jewelry is often chosen as a gift because the motif is associated with affection and meaningful connections.
Can this earring be worn in other piercings?
Cartilage earrings designed for helix placement may also be worn in other suitable piercings depending on personal style and jewelry compatibility.