Genuine Ethiopian Opal Flower Engagement Ring With Real Diamond

Regular price £349.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Embrace the enchanting beauty of nature with this Flower Engagement Ring, where romance blossoms in every detail. This Nature Inspired Engagement Ring features a 5 mm Round Shape Ethiopian Opal that shines brilliantly, set in Prong Setting within a delicate Rose Flower motif that captures the essence of timeless love and natural elegance. Surrounding the vibrant Opal, the band unfolds into graceful leaf patterns, adorned with sparkling Diamond stones that add a whisper of brilliance and sophistication. This Opal Diamond Engagement Ring is a stunning fusion of organic artistry and refined craftsmanship, perfect for those who seek a unique symbol of their forever love. Whether you are proposing or celebrating a special bond, this Opal Engagement Ring brings a fresh, whimsical charm to the classic engagement ring tradition. Offered in various sizes and presented in a luxurious jewelry box, this Opal Flower Ring is ready to dazzle from the very first glance. This Real Opal Ring is a wearable garden of dreams, capturing the delicate dance of petals and light in a piece as extraordinary as your love story.

Product Information
SKU SHP-RINGS0821187975
Width 6 mm
Height 8 mm
Metal Weight 3.83 gm (Approximate)
Center Stone Weight 0.51 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 36 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-36 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
opal-engagement-rings