Genuine Tahitian Black Pearl and Diamond Flower Stud Earrings

Regular price £796.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Graceful detailing and natural beauty come together in a Tahitian Pearl Stud Earrings designed to feel both elegant and distinctive. Features an 8 MM solitaire Tahitian pearl, admired for its luminous tones and smooth surface. The pearl is surrounded by a carefully crafted metal frame that forms a floral motif inspired by nature. Accenting the flower design, round cut diamonds are set in prong setting, adding a gentle sparkle that enhances the pearl’s natural glow. Designed for comfort and secure wear, the Pearl and Diamond Earrings are finished with screw-back closures, making them suitable for long hours of wear and everyday confidence. Its stud style keeps the look polished and versatile, allowing it to pair beautifully with both casual outfits and formal attire. Perfect for special occasions, thoughtful gifting, or adding a refined touch to daily wear, these Pearl Flower Earrings stand out through their craftsmanship and attention to detail.

Product Information
SKU SHP-EARRINGS102025952
Length 12.8 mm
Width 12.8 mm
Height 7.5 mm
Metal Weight 2.80 gm (Approximate)
Total Stone Weight 15.78 Carat (Approximate)
TAHITIAN PEARL INFORMATION
No.of Stones 2 Pieces
Total Weight 15.00 Carat (Approximate)
Dimension(approx) Round-8X8 mm-2 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.78 Carat (Approximate)
Dimension(approx) Round-1.60X1.60 mm-10 Pcs
Round-2X2 mm-10 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
tahitian-pearl-earrings