Genuine Tanzanite Rose Flower Engagement Ring with Diamond Curved Shank

Regular price £384.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Timeless yet full of life, this Flower Engagement Ring is a celebration of love in its most delicate and dazzling form. At the center blooms a 5 mm Round Shape Tanzanite set in Prong Setting, radiating a rich, enchanting color that seems to change with every glance, just like the many emotions shared between two hearts. Surrounding it, the flower motif evokes the beauty of the tender moments of nature, while the Curved shank, studded with dainty Diamond stones, adds a subtle sparkle that catches the light with every movement. Designed to be more than just a piece of jewelry, this Tanzanite Engagement Ring captures a promise, a memory, a future together, making it perfect for those unforgettable milestones. This Tanzanite Diamond Ring comes in a signature jewelry box and in multiple sizes, so your gesture feels special and meant to last a lifetime. Whether it is an engagement, a symbol of commitment or simply a way to show how deeply you care, this Nature Inspired Engagement Ring is a poetic reminder that love is meant to be cherished forever.

Product Information
SKU SHP-RINGS0821183116
Width 5.4 mm
Height 8 mm
Metal Weight 2.70 gm (Approximate)
Center Stone Weight 0.54 Carat (Approximate)
TANZANITE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.54 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-18 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
tanzanite-engagement-rings