Heart Shape Diamond Dog Paw Print Earring

Regular price £310.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Designed for Pet Lovers

The heart shape diamond dog paw print earring is created for those who want their jewelry to carry personal meaning. The paw motif symbolizes companionship and loyalty, while the heart outline adds emotional depth without overwhelming the design.

This piece is intended for everyday wear, offering a balance between sentiment and refined styling suitable for regular use.

Design & Setting Intent

The heart silhouette frames the paw print cleanly, keeping the design visually centered and easy to wear. Smooth edges and a compact profile help the earring sit comfortably without appearing bulky.

Diamond Use & Suitability

Diamonds used in this design are suitable for regular jewelry wear. When lab-grown diamonds are used, they are created without traditional mining, and impact varies by production and energy source.

High-Level Features

  • Heart shape paw print motif
  • Diamond-accented symbolic design
  • Comfort-focused proportions
  • Suitable for everyday wear
Product Information
SKU SHP-BODYJ082410099
Length 5 mm
Width 5.5 mm
Height 2 mm
Metal Weight 0.50 gm (Approximate)
Total Stone Weight 0.21 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.21 Carat (Approximate)
Dimension(approx) Heart-3X3 mm-1 Pcs
Round-1.50X1.50 mm-4 Pcs
Color HI
Cut Brilliant
Shape Heart, Round
Setting Type Bezel-Setting
Quality Grade SI
View More
Is this earring suitable for daily wear?
This earring is designed for regular wear when used as intended and maintained properly.
Is this sold as a single earring or a pair?
Please refer to the product details table to confirm whether the item is sold as a single piece or as a pair.
Does the heart shape make the earring bulky?
The heart shape is proportioned to remain balanced and comfortable without adding excess bulk.
Is this earring suitable as a gift?
The symbolic paw print design makes it suitable for gifting to pet lovers or for commemorative occasions.
Will the design snag on clothing?
Smooth contours are intended to reduce the likelihood of snagging during normal wear.