Lab Created Blue Sapphire Hoop Drop Earrings With Certificate

Sale price £628.00 Regular price £722.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K White Gold
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

The Lab Created Blue Sapphire Hoop Drop Earrings With Certificate bring together rich blue color, sunburst artistry, and graceful movement in one expressive pair. Each earring holds a 5 MM round lab created blue sapphire in a secure bezel setting, framed by a radiant sun-inspired motif that gives the design its distinctive glow.

Suspended from hinged hoops, the sapphire drops move gently as you turn, adding a polished flash of color without feeling heavy or overdone. These earrings are a thoughtful gift for September birthdays, anniversaries, personal milestones, or anyone who loves meaningful blue gemstone jewelry with a nature-inspired finish.

Lab Created Blue Sapphire Hoop Drop Earrings with Bezel Set

These hoop drop earrings feature two round brilliant cut lab created blue sapphires of AAAA quality, with an approximate total gemstone weight of 1.30 carat. Each 5X5 MM blue sapphire is secured in a bezel setting and framed with a sunburst design, creating a bright focal point beneath the hinged hoop. The earrings measure approximately 28 MM in length and 10.3 MM in width, with an approximate weight of 3.89 GM. Available metal options include 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

What Makes This Special

The design centers on two lab created blue sapphires, one in each earring, giving the pair a balanced look and vivid blue presence. The round brilliant cut helps bring light into the stones, while the AAAA quality grade supports a refined gemstone appearance.

The bezel setting surrounds each sapphire with metal, creating a smooth and secure frame. Around the stone, the sunburst pattern adds dimension and a nature-inspired character that makes these earrings feel more expressive than a simple gemstone drop.

The hinged hoop structure is practical and comfortable, while the drop detail adds movement. With a 28 MM length and 10.3 MM width, the pair offers noticeable style without losing everyday wearability.

Why Choose This Design

Round blue sapphires are chosen for their balanced shape and deep color, making them easy to style while still feeling personal. The brilliant cut gives the sapphires a lively surface sparkle, and the bezel setting helps protect the stones while creating a smooth finished look.

The sunburst frame gives the earrings their visual identity. It draws attention toward the blue sapphire center and adds a sense of warmth and artistry to the pair. The hinged hoop closure also makes the earrings secure for regular wear, making them suitable for both daily styling and special occasions.

Design Meaning

The sunburst design can represent light, optimism, renewal, and personal radiance. Paired with blue sapphire, the earrings carry a message of calm confidence, sincerity, and inner strength.

Blue sapphire is also associated with September birthstone jewelry, making this pair meaningful for September birthdays or anyone who feels connected to the stone’s deep blue color. The drop silhouette adds movement, giving the earrings a graceful sense of life and celebration.

Authenticity & Craftsmanship

These earrings are crafted with two round brilliant cut lab created blue sapphires in AAAA quality, each set securely in a bezel setting. The hinged hoop construction is designed for comfortable wear, while the sunburst detailing adds precise texture and sculptural depth around each gemstone.

The earrings include a Certificate of Authenticity, offering added confidence in the gemstone details and craftsmanship. Rosec Jewels’ trust details also include certified jewelry, precious metal only, hand checking, free and insured shipping, and 30 days free return. For care, clean the earrings gently with mild soapy water and a soft brush, avoid harsh chemicals, and store them separately when not worn.

Style and Wearability

From the front, the earrings show a bold blue sapphire framed by pointed sunburst rays. From the side, the hinged hoop and hanging drop create a slim, graceful profile with movement that catches attention as the wearer turns.

They pair well with casual outfits, workwear, evening styling, and layered jewelry looks. The metal choices allow the wearer to select a cool white gold finish or a warm yellow gold tone, making the earrings easy to match with existing jewelry and personal style.

Product Information
SKU SHP-EARRINGS0621107121
Length 28 mm
Width 10.3 mm
Weight 3.89 gm (Approximate)
Center Stone Weight 1.30 Carat (Approximate)
LAB CREATED BLUE SAPPHIRE INFORMATION
No.of Stones 2 Pieces
Total Weight 1.30 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Bezel-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
lab-created-blue-sapphire-earrings

FAQs About: Lab Created Blue Sapphire Hoop Drop Earrings With Certificate

What makes these lab created blue sapphire hoop drop earrings special?

These earrings combine hinged hoops with hanging sunburst drops, each centered with a 5 MM round lab created blue sapphire. The bezel setting, blue gemstone color, and radiant sun-inspired frame give the pair a distinctive look with secure everyday wearability.

What gemstone details are used in these earrings?

The earrings feature two round brilliant cut lab created blue sapphires, each measuring approximately 5X5 MM. The total gemstone weight is approximately 1.30 carat, and the sapphires are crafted with AAAA quality grade.

What setting and closure style do these earrings have?

Each blue sapphire is secured in a bezel setting, which surrounds the stone with a smooth metal frame. The earrings use hinged hoop closures for a secure and comfortable fit.

Do these earrings come with a Certificate of Authenticity?

Yes. These lab created blue sapphire hoop drop earrings include a Certificate of Authenticity, adding confidence in the gemstone details and craftsmanship.

What metal options are available for these earrings?

The available metal options include 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Are these sapphire hoop earrings suitable for gifting?

Yes. Their blue sapphire center, sunburst drop design, hinged hoop style, and certificate make them a thoughtful gift for September birthdays, anniversaries, celebrations, or a personal jewelry milestone.

How should I care for these blue sapphire hoop drop earrings?

Clean the earrings gently with mild soapy water, a soft brush, and a lint-free cloth. Avoid harsh chemicals, check the hinged closures before wearing, and store the pair separately to help protect the sapphires, bezel settings, and metal finish.