Lab Created Emerald Floral Stud Earrings with Diamond Halo

Sale price £487.00 Regular price £560.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Emerald Floral Stud Earrings

These stud earrings feature lab created emeralds arranged in a floral-inspired design, surrounded by a halo of diamonds that enhance the overall brilliance. The combination of vibrant green gemstones and sparkling diamonds creates a balanced design that draws attention while maintaining refined elegance.

The floral motif introduces a soft and decorative element, making the earrings suitable for both everyday wear and special occasions.

Floral Inspired Jewelry Design

Floral jewelry designs are known for their graceful structure and organic visual appeal. The petal-like arrangement of gemstones creates a shape that reflects natural forms while maintaining a balanced and symmetrical composition.

This design style is widely appreciated in fine jewelry for its ability to combine artistic detail with timeless elegance.

Lab Created Emerald Center Stones

Lab created emeralds display the rich green color associated with natural emeralds while being produced in a controlled environment. They are created without traditional mining, though environmental impact may vary depending on production methods and energy sources.

Their vivid color makes them a striking centerpiece for jewelry designs that emphasize gemstone beauty and contrast.

Diamond Halo Accents

The diamond halo surrounding the emeralds introduces additional brilliance and sparkle. Halo settings are commonly used in jewelry to enhance the visual presence of the center gemstone while adding depth to the overall design.

Together, the emeralds and diamonds create a harmonious combination of vibrant color and light-reflecting brilliance.

Product Information
SKU SHP-EARRINGS022012430
Length 9.4 mm
Width 9.4 mm
Height 3.9 mm
Metal Weight 2.30 gm (Approximate)
Total Stone Weight 2.32 Carat (Approximate)
LAB CREATED EMERALD INFORMATION
No.of Stones 2 Pieces
Total Weight 1.60 Carat (Approximate)
Dimension(approx) Round-6X6 mm-2 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 24 Pieces
Total Weight 0.72 Carat (Approximate)
Dimension(approx) Round-1.70X1.70 mm-24 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-emerald-earrings

FAQs About: Lab Created Emerald Floral Stud Earrings with Diamond Halo

What are lab created emeralds?
Lab created emeralds are gemstones produced in controlled environments that replicate the natural formation process, resulting in stones with similar visual and physical characteristics.
What is a halo setting in earrings?
A halo setting features smaller diamonds placed around a central gemstone, enhancing its visual size and brilliance.
Why are floral jewelry designs popular?
Floral designs are popular because they introduce soft, organic shapes into jewelry while maintaining elegance and timeless appeal.
Are emerald and diamond combinations common in jewelry?
Yes, emeralds are often paired with diamonds because the diamonds add brightness and contrast to the rich green color of the gemstone.
Can stud earrings be worn daily?
Stud earrings are commonly chosen for everyday wear because of their secure design and versatile style.
What occasions are emerald stud earrings suitable for?
Emerald stud earrings can be worn for both everyday occasions and formal events due to their balanced combination of color and sparkle.