Lab Created Ruby Rose Flower Engagement Ring With Certificate

Sale price £293.00 Regular price £337.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Romantic Rose-Inspired Design

This lab created ruby rose flower engagement ring is designed for those who appreciate symbolism and artistry. The floral silhouette captures the essence of a blooming rose, representing love and commitment through thoughtful craftsmanship.

The sculpted petal-inspired design gives the ring dimension and character, making it a meaningful alternative to traditional solitaire styles.

Vivid Ruby at the Heart

At the center of the floral motif sits a lab created ruby, chosen for its rich red hue and consistent brilliance. The gemstone’s vibrant tone draws the eye inward, anchoring the design with warmth and intensity.

Its placement within the rose structure enhances both the color and the symbolic narrative of the piece.

Created Ruby with Certification

A lab created ruby offers the visual beauty of ruby while being formed under controlled conditions. It is created without traditional mining, though impact varies by production and energy source.

The included certification provides added assurance regarding the gemstone’s authenticity and characteristics, supporting informed purchasing decisions.

High-Level Features

This engagement ring features a lab created ruby in a rose flower inspired setting and comes with certification. The design focuses on symbolic floral detailing, vivid color, and a distinctive silhouette that sets it apart from classic engagement styles.

Product Information
SKU SHP-RINGS082217405
Width 5 mm
Height 11.5 mm
Metal Weight 3.22 gm (Approximate)
Center Stone Weight 0.65 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.65 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 18 Pieces
Total Weight 0.23 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stone-shape-swatches

FAQs About: Ruby Rose Flower Engagement Ring

What does a rose flower engagement ring symbolize?
A rose-inspired engagement ring often symbolizes love, passion, and commitment. The floral form adds a romantic and meaningful touch to the design.
What is a lab created ruby?
A lab created ruby is produced under controlled conditions to replicate the properties and appearance of natural ruby. It offers consistent color and clarity while being created without traditional mining.
What does the certificate include?
The certificate provides details about the gemstone’s characteristics and verifies that the ruby is lab created, offering transparency and documentation for your purchase.
Is this floral ring suitable for daily wear?
With appropriate care, this ring can be worn regularly. Its structured floral setting is designed to hold the center stone securely while maintaining its decorative form.
Can this ring be paired with a simple wedding band?
Many choose to pair a floral engagement ring with a simple, complementary band to balance the detailed design while preserving the rose motif as the focal point.